AV35094
Anti-KCNN2 antibody produced in rabbit
IgG fraction of antiserum
Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych
About This Item
Polecane produkty
pochodzenie biologiczne
rabbit
Poziom jakości
białko sprzężone
unconjugated
forma przeciwciała
IgG fraction of antiserum
rodzaj przeciwciała
primary antibodies
klon
polyclonal
Postać
buffered aqueous solution
masa cząsteczkowa
64 kDa
reaktywność gatunkowa
yeast, human
stężenie
0.5 mg - 1 mg/mL
metody
immunohistochemistry: suitable
western blot: suitable
numer dostępu NCBI
numer dostępu UniProt
Warunki transportu
wet ice
temp. przechowywania
−20°C
docelowa modyfikacja potranslacyjna
unmodified
informacje o genach
human ... KCNN2(3780)
Opis ogólny
KCNN2 codes for an integral membrane protein that forms a part of a voltage-independent calcium-activated channel. KCNN2 deletions have been implicated in behavioural defects.
Rabbit Anti-KCNN2 antibody recognizes human, mouse, rat, bovine, pig, chicken, canine, and zebrafish KCNN2.
Rabbit Anti-KCNN2 antibody recognizes human, mouse, rat, bovine, pig, chicken, canine, and zebrafish KCNN2.
Immunogen
Synthetic peptide directed towards the C terminal region of human KCNN2
Zastosowanie
Rabbit Anti-KCNN2 antibody is suitable for western blot applications at a concentration of 1.25 μg/ml.
Działania biochem./fizjol.
Action potentials in vertebrate neurons are followed by an afterhyperpolarization (AHP) that may persist for several seconds and may have profound consequences for the firing pattern of the neuron. Each component of the AHP is kinetically distinct and is mediated by different calcium-activated potassium channels. The protein encoded by KCNN2 is activated before membrane hyperpolarization and is thought to regulate neuronal excitability by contributing to the slow component of synaptic AHP. The encoded protein is an integral membrane protein that forms a voltage-independent calcium-activated channel with three other calmodulin-binding subunits. KCNN2 is a member of the KCNN family of potassium channel genes.
Sekwencja
Synthetic peptide located within the following region: IDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNIMYDM
Postać fizyczna
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Oświadczenie o zrzeczeniu się odpowiedzialności
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
This page may contain text that has been machine translated.
Nie możesz znaleźć właściwego produktu?
Wypróbuj nasz Narzędzie selektora produktów.
Kod klasy składowania
10 - Combustible liquids
Klasa zagrożenia wodnego (WGK)
WGK 3
Temperatura zapłonu (°F)
Not applicable
Temperatura zapłonu (°C)
Not applicable
Certyfikaty analizy (CoA)
Poszukaj Certyfikaty analizy (CoA), wpisując numer partii/serii produktów. Numery serii i partii można znaleźć na etykiecie produktu po słowach „seria” lub „partia”.
Masz już ten produkt?
Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.
Bridget M McKay et al.
Journal of neurophysiology, 108(3), 863-870 (2012-05-04)
Enhanced intrinsic neuronal excitability of hippocampal pyramidal neurons via reductions in the postburst afterhyperpolarization (AHP) has been hypothesized to be a biomarker of successful learning. This is supported by considerable evidence that pharmacologic enhancement of neuronal excitability facilitates learning. However
Marek Szatanik et al.
Neurogenetics, 9(4), 237-248 (2008-07-08)
Small-conductance Ca(2+)-activated potassium (SK) channels are heteromeric complexes of SK alpha-subunits and calmodulin that modulate membrane excitability, are responsible for part of the after-hyperpolarization (AHP) following action potentials, and thus control the firing patterns and excitability of most central neurons.
Yong-Chao Lu et al.
The Journal of clinical endocrinology and metabolism, 99(10), 3800-3810 (2014-07-01)
Small-conductance, Ca(2+)-activated K(+) channel 3 (SK3) has been shown to be expressed in porcine endometrium. However, the roles of SK3 in human endometrium during the menstrual cycle and early pregnancy are unknown. The objective of the study was to investigate
Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.
Skontaktuj się z zespołem ds. pomocy technicznej