05-23-2150

PACAP 38, Ovine

More active than vasoactive intestinal peptide (VIP) in stimulating adenylate cyclase (EC₅₀ = 7 nM).

• Synonim(y): PACAP 38, Ovine, Pituitary Adenylate Cyclase Activating Polypeptide, HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH₂
• Wzór empiryczny (zapis Hilla): C₂₀₃H₃₃₁N₆₃O₅₃S
• Numer CAS: 137061-48-4
• Masa cząsteczkowa: 4534.26
• Numer MDL: MFCD00081800
• Kod UNSPSC: 12352202
• NACRES: NA.77

Właściwości

• Poziom jakości: 100
• Próba: ≥96% (HPLC)
• Postać: solid
• producent / nazwa handlowa: Calbiochem^®
• warunki przechowywania: OK to freeze; desiccated (hygroscopic)
• kolor: white to off-white
• rozpuszczalność: 5% acetic acid: 1 mg/mL
• Warunki transportu: ambient
• temp. przechowywania: −20°C

Opis

Opis ogólny

More active than vasoactive intestinal peptide (VIP) in stimulating adenylate cyclase (EC₅₀ = 7 nM).

Działania biochem./fizjol.

Cell permeable: no

EC50 = 7 nM against adenylate cyclase

Primary Target
Adenylate cyclase

Product does not compete with ATP.

Reversible: no

Opakowanie

Yes

Ostrzeżenie

Toxicity: Standard Handling (A)

Sekwencja

H-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH₂

Rekonstytucja

Following reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.

Inne uwagi

Kobayashi, H., et al. 1994. Brain Res.647, 145.
Chastre, E., et al. 1991. J. Biol. Chem.266, 21239.
Le Meuth, V., et al. 1991. Am. J. Physiol. 260, G265.
Kimura, C., et al. 1990. Biochem. Biophys. Res. Commun.166, 81.

Informacje prawne

CALBIOCHEM is a registered trademark of Merck KGaA, Darmstadt, Germany

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 11 - Combustible Solids
• Klasa zagrożenia wodnego (WGK): WGK 3
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable