05-23-2150

PACAP 38, Ovine

More active than vasoactive intestinal peptide (VIP) in stimulating adenylate cyclase (EC₅₀ = 7 nM).

• Synonym(s): PACAP 38, Ovine, Pituitary Adenylate Cyclase Activating Polypeptide, HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH₂
• Empirical Formula (Hill Notation): C₂₀₃H₃₃₁N₆₃O₅₃S
• CAS Number: 137061-48-4
• Molecular Weight: 4534.26
• MDL number: MFCD00081800
• UNSPSC Code: 12352202

Properties

• Quality Level: 100
• Assay: ≥96% (HPLC)
• form: solid
• manufacturer/tradename: Calbiochem^®
• storage condition: OK to freeze; desiccated (hygroscopic)
• color: white to off-white
• solubility: 5% acetic acid: 1 mg/mL
• shipped in: ambient
• storage temp.: −20°C

Description

General description

More active than vasoactive intestinal peptide (VIP) in stimulating adenylate cyclase (EC₅₀ = 7 nM).

Biochem/physiol Actions

Cell permeable: no

EC50 = 7 nM against adenylate cyclase

Primary Target
Adenylate cyclase

Product does not compete with ATP.

Reversible: no

Packaging

Yes

Warning

Toxicity: Standard Handling (A)

Sequence

H-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH₂

Reconstitution

Following reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.

Other Notes

Kobayashi, H., et al. 1994. Brain Res.647, 145.
Chastre, E., et al. 1991. J. Biol. Chem.266, 21239.
Le Meuth, V., et al. 1991. Am. J. Physiol. 260, G265.
Kimura, C., et al. 1990. Biochem. Biophys. Res. Commun.166, 81.

Legal Information

CALBIOCHEM is a registered trademark of Merck KGaA, Darmstadt, Germany

Safety Information

• Storage Class Code: 11 - Combustible Solids
• WGK: WGK 3
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable