Skip to Content
Merck
All Photos(3)

Key Documents

SAB1401367

Sigma-Aldrich

Monoclonal Anti-SNAI1 antibody produced in mouse

clone 1A5, purified immunoglobulin, buffered aqueous solution

Synonym(s):

SLUGH2, SNA, SNAH, dJ710H13.1

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

1A5, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

capture ELISA: suitable
immunoprecipitation (IP): suitable
western blot: 1-5 μg/mL

isotype

IgG1κ

NCBI accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... SNAI1(6615)

General description

The Drosophila embryonic protein snail is a zinc finger transcriptional repressor which downregulates the expression of ectodermal genes within the mesoderm. The nuclear protein encoded by this gene is structurally similar to the Drosophila snail protein, and is also thought to be critical for mesoderm formation in the developing embryo. At least two variants of a similar processed pseudogene have been found on chromosome 2. (provided by RefSeq)

Immunogen

SNAI1 (NP_005976.2, 121 a.a. ~ 230 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
LEAEAYAAFPGLGQVPKQLAQLSEAKDLQARKAFNCKYCNKEYLSLGALKMHIRSHTLPCVCGTCGKAFSRPWLLQGHVRTHTGEKPFSCPHCSRAFADRSNLRAHLQTH

Physical form

Solution in phosphate buffered saline, pH 7.4

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Z Xu et al.
Oncogene, 33(22), 2836-2845 (2013-06-25)
High malignancy and early metastasis are the hallmarks of hepatocellular carcinoma (HCC). Here, we report that Cezanne2 expression is downregulated in HCC cells and in HCC patients' tumorous tissues and that Cezanne2 is inversely associated with Snail1 expression in HCC
H Dong et al.
Clinical & translational oncology : official publication of the Federation of Spanish Oncology Societies and of the National Cancer Institute of Mexico, 16(9), 783-791 (2013-12-21)
The poor prognosis of gastroesophageal junction (GEJ) adenocarcinoma is largely associated with metastasis. We here report the first study to investigate the expression of epithelial-mesenchymal transition (EMT) markers Snail1 and E-cadherin in GEJ adenocarcinoma. Snail1 and E-cadherin were detected by
Y Bao et al.
British journal of cancer, 111(5), 933-943 (2014-07-18)
Chicken ovalbumin upstream promoter-transcription factor II (COUP-TFII, also known as NR2F2) promotes metastasis by functioning in the tumour microenvironment; however, the role of COUP-TFII in colorectal cancer remains unknown. Human colon adenocarcinoma tissues were collected to test COUP-TFII expression. Wound-healing

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service