Skip to Content
Merck
All Photos(5)

Key Documents

WH0004282M1

Sigma-Aldrich

Monoclonal Anti-MIF antibody produced in mouse

clone 2A10-4D3, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-GIF, Anti-GLIF, Anti-MMIF, Anti-macrophage migration inhibitory factor (glycosylation-inhibiting factor)

Sign Into View Organizational & Contract Pricing


About This Item

MDL number:
UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

2A10-4D3, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
immunoprecipitation (IP): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG1κ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

glycosylation

Gene Information

human ... MIF(4282)

General description

Macrophage migration inhibitory factor (MIF) is a 37.5kDa homotrimer protein. It is expressed in various cells like monocytes, macrophages, vascular smooth muscle cells (SMCs) and cardiomyocytes. This gene is located on human chromosome 21q22.33.(1)
This gene encodes a lymphokine involved in cell-mediated immunity, immunoregulation, and inflammation. It plays a role in the regulation of macrophage function in host defense through the suppression of anti-inflammatory effects of glucocorticoids. This lymphokine and the JAB1 protein form a complex in the cytosol near the peripheral plasma membrane, which may indicate an additional role in integrin signaling pathways. (provided by RefSeq)

Immunogen

MIF (AAH00447.1, 1 a.a. ~ 115 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA

Biochem/physiol Actions

Macrophage migration inhibitory factor (MIF) can induce inflammation. Aberrations in MIF result in several inflammatory diseases, such as ulcerative colitis (UC), psoriasis and tuberculosis (TB).(1) It controls the anti-inflammator effects of glucocorticoids. MIF plays pro-inflammatory roles in inflammatory diseases like rheumatoid arthritis, sepsis, acute respiratory distress syndrome and glomerulonephritis.(2)

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Macrophage migration inhibitory factor promoter polymorphisms (-794 CATT5-8): Relationship with soluble MIF levels in coronary atherosclerotic disease subjects
Qian L, et al.
BMC Cardiovascular Disorders, 17(1) (2017)
A functional promoter polymorphism in the macrophage migration inhibitory factor (MIF) gene associated with disease severity in rheumatoid arthritis
Baugh JA, et al.
Genes and Immunity, 3(3), 170-176 (2002)
Juneo Freitas Silva et al.
Reproduction (Cambridge, England), 147(6), 803-816 (2014-02-19)
The objective of the present study was to evaluate the gene and immunohistochemical expression of inflammatory mediators involved in the immune activity and the intrauterine trophoblast migration of the placentas in hypothyroid and L-thyroxine (L-T4)-treated rats. A total of 144
Dake Qi et al.
The Journal of clinical investigation, 124(8), 3540-3550 (2014-07-02)
The cellular response to stress involves the recruitment and coordination of molecular signaling pathways that prevent cell death. D-dopachrome tautomerase (DDT) is an enzyme that lacks physiologic substrates in mammalian cells, but shares partial sequence and structural homology with macrophage

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service