WH0001997M1

Monoclonal Anti-ELF1 antibody produced in mouse

clone 3B7, purified immunoglobulin, buffered aqueous solution

• Sinónimos: Anti-E74-like factor 1 (ets domain transcription factor)
• UNSPSC Code: 12352203
• NACRES: NA.41

Propiedades

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 3B7, monoclonal
• form: buffered aqueous solution
• species reactivity: human
• technique(s): indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotype: IgG2bκ
• GenBank accession no.: NM_172373
• UniProt accession no.: P32519
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... ELF1(1997)

Descripción

General description

This gene encodes an E26 transformation-specific related transcription factor. The encoded protein is primarily expressed in lymphoid cells and acts as both an enhancer and a repressor to regulate transcription of various genes. Alternative splicing results in multiple transcript variants. (provided by RefSeq)

Immunogen

ELF1 (NP_758961, 421 a.a. ~ 520 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
IQAPTQVPVVVSPRNQQLHTVTLQTVPLTTVIASTDPSAGTGSQKFILQAIPSSQPMTVLKENVMLQSQKAGSPPSIVLGPAQVQQVLTSNVQTICNGTV

Features and Benefits

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Información de seguridad

• Storage Class: 10 - Combustible liquids
• flash_point_f: Not applicable
• flash_point_c: Not applicable
• ppe: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)