SAB5702432

Anti-Carbonic Anhydrase 1 (CA1) Antibody, clone 0G10F8, Rabbit Monoclonal

• Sinónimos: CA-I, CAB, Car1, HEL-S-11
• UNSPSC Code: 12352203
• NACRES: NA.41

Propiedades

• biological source: rabbit
• Quality Level: 100
• material: colorless
• clone: 0G10F8, monoclonal
• form: liquid
• mol wt: 29 kDa
• species reactivity: rat, mouse
• concentration: 0.75 mg/mL
• technique(s): western blot: 1:500 - 1:2000
• color: colorless
• isotype: IgG
• immunogen sequence: KVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
• UniProt accession no.: P00915
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... CA1(759)

Descripción

General description

Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. This CA1 gene is closely linked to the CA2 and CA3 genes on chromosome 8. It encodes a cytosolic protein that is found at the highest level in erythrocytes. Allelic variants of this gene have been described in some populations. Alternative splicing and the use of alternative promoters results in multiple transcript variants. [provided by RefSeq, Nov 2016]

Immunogen

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Recombinant fusion protein containing a sequence corresponding to amino acids 160-261 of human Carbonic Anhydrase 1 (CA1) (CA1) (P00915).

Application

WB

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 1