Saltar al contenido
Merck
Todas las fotos(1)

Key Documents

SAB2105061

Sigma-Aldrich

Anti-OTUD6B antibody produced in rabbit

affinity isolated antibody

Sinónimos:

Anti-CGI-77, Anti-duba5

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

37 kDa

species reactivity

dog, rat, horse, human, guinea pig, mouse, bovine, goat, rabbit

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... OTUD6B(51633)

General description

The gene OTUD6B (OTU domain containing 6B) is mapped to human chromosome 8q21. The encoded protein belongs to the OTU (ovarian tumor) family of proteins. OTUD6B is a deubiquitinating enzyme which can be induced by cytokines.

Immunogen

Synthetic peptide directed towards the middle region of human OTUD6B

Biochem/physiol Actions

In B lymphocytes, OTUD6B (OTU domain containing 6B) negatively regulates cell proliferation. In transgenic mouse (TgMMTV-neu) model, OTUD6B autoantibodies were detected prior to the development of breast cancer and might be used for the early human cancer detection.

Sequence

Synthetic peptide located within the following region: EIIQADSPPIIVGEEYSKKPLILVYMRHAYGLGEHYNSVTRLVNIVTENC

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 3

flash_point_f

Not applicable

flash_point_c

Not applicable


Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Zhongping Xu et al.
PloS one, 6(1), e14514-e14514 (2011-01-27)
Deubiquitinating enzymes (DUBs) are important regulators of cell proliferation. Here we identified a functional deubiquitinating enzyme, ovarian tumor domain-containing 6B (OTUD-6B). Mutation of the conserved Cys residue abolished its deubiquitinating activity in vitro. Otud-6b expression was induced with cytokine stimulation
Jianning Mao et al.
Journal of translational medicine, 12, 121-121 (2014-06-03)
The use of autoantibodies for the early detection of breast cancer has generated much interest as antibodies can be readily assayed in serum when antigen levels are low. Ideally, diagnostic autoantibodies would be identified in individuals who harbored pre-invasive disease/high
Sehrish Rafique et al.
Genome biology, 16, 145-145 (2015-08-04)
Epigenetic changes are being increasingly recognized as a prominent feature of cancer. This occurs not only at individual genes, but also over larger chromosomal domains. To investigate this, we set out to identify large chromosomal domains of epigenetic dysregulation in

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico