AV43692

Anti-ABCB9 antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-ATP-binding cassette, sub-family B (MDR/TAP), member 9, Anti-EST122234, Anti-KIAA1520, Anti-TAPL
• UNSPSC Code: 12352203
• NACRES: NA.41

Propiedades

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 80 kDa
• species reactivity: rat, bovine, dog, human, mouse
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NP_982269
• UniProt accession no.: Q9NP78
• shipped in: wet ice
• storage temp.: −20°C
• Gene Information: human ... ABCB9(23457)

Descripción

Immunogen

Synthetic peptide directed towards the N terminal region of human ABCB9

Biochem/physiol Actions

ABCB9 belongs to the ATP-binding cassette (ABC) transporters superfamily and is involved in transport of molecules across extra- and intra-cellular membranes. It is reportedly associated with the lysosomes at high levels in testes and moderate levels in brain and spinal cord.

Sequence

Synthetic peptide located within the following region: RLWKAVVVTLAFMSVDICVTTAIYVFSHLDRSLLEDIRHFNIFDSVLDLW

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable