WH0004093M2

Monoclonal Anti-SMAD9 antibody produced in mouse

clone 3E5, purified immunoglobulin, buffered aqueous solution

• 동의어(들): Anti-MADH6, Anti-MADH9, Anti-SMAD, mothers against DPP homolog 9 (Drosophila), Anti-SMAD8A, Anti-SMAD8B
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: mouse
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 3E5, monoclonal
• 양식: buffered aqueous solution
• 종 반응성: human
• 기술: indirect ELISA: suitable; western blot: 1-5 μg/mL
• 동형: IgG2aκ
• GenBank 수납 번호: NM_005905
• UniProt 수납 번호: O15198
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... SMAD9(4093)

설명

일반 설명

SMAD family members, such as SMAD9, transduce signals from members of the TGF-beta (see TGFB1; MIM 190180) superfamily, which regulate growth, differentiation, apoptosis, and development (Nishita et al., 1999 [PubMed 10583507]).[supplied by OMIM

면역원

SMAD9 (NP_005896, 146 a.a. ~ 260 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
RHSEYNPQLSLLAKFRSASLHSEPLMPHNATYPDSFQQPPCSALPPSPSHAFSQSPCTASYPHSPGSPSEPESPYQHSDFRPVCYEEPQHWCSVAYYELNNRVGETFQASSRSVL

물리적 형태

Solution in phosphate buffered saline, pH 7.4

법적 정보

GenBank is a registered trademark of United States Department of Health and Human Services

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable
• 개인 보호 장비: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)