WH0000537M1

Monoclonal Anti-ATP6AP1 antibody produced in mouse

clone 3A2, purified immunoglobulin, buffered aqueous solution

• 동의어(들): Anti-16A, Anti-ATP6IP1, Anti-ATP6S1, Anti-ATPase, H+ transporting, lysosomal accessory protein 1, Anti-Ac45, Anti-CF2, Anti-MGC129781, Anti-ORF, Anti-VATPS1, Anti-XAP3
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: mouse
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 3A2, monoclonal
• 형태: buffered aqueous solution
• 종 반응성: rat, mouse, human
• 기술: indirect ELISA: suitable; western blot: 1-5 μg/mL
• 동형: IgG1κ
• GenBank 수납 번호: NM_001183
• UniProt 수납 번호: Q15904
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... ATP6AP1(537)

설명

일반 설명

This gene encodes a component of a multisubunit enzyme (1 mDa MW) that mediates acidification of eukaryotic intracellular organelles. Vacuolar ATPase (V-ATPase) is comprised of a cytosolic V1 (site of the ATP catalytic site) and a transmembrane V0 domain. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, and receptor-mediated endocytosis. The encoded protein of this gene is approximately 45 kD and may assist in the V-ATPase-mediated acidification of neuroendocrine secretory granules. (provided by RefSeq)

면역원

ATP6AP1 (NP_001174, 51 a.a. ~ 150 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SSDRDLWAPAADTHEGHITSDLQLSTYLDPALELGPRNVLLFLQDKLSIEDFTAYGGVFGNKQDSAFSNLENALDLAPSSLVLPAVDWYAVSTLTTYLQE

특징 및 장점

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

물리적 형태

Solution in phosphate buffered saline, pH 7.4

법적 정보

GenBank is a registered trademark of United States Department of Health and Human Services

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable
• 개인 보호 장비: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)