SAB1402660

Monoclonal Anti-ACVR1C antibody produced in mouse

clone 2E3, purified immunoglobulin, buffered aqueous solution

• 동의어(들): ACVRLK7, ALK7
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: mouse
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 2E3, monoclonal
• 형태: buffered aqueous solution
• 분자량: antigen ~35.9 kDa
• 종 반응성: human
• 기술: indirect ELISA: suitable; proximity ligation assay: suitable
• 동형: IgG2aκ
• NCBI 수납 번호: BC022530
• UniProt 수납 번호: Q8NER5
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... ACVR1C(130399)

설명

일반 설명

ACVR1C is a type I receptor for the TGFB (see MIM 190180) family of signaling molecules. Upon ligand binding, type I receptors phosphorylate cytoplasmic SMAD transcription factors, which then translocate to the nucleus and interact directly with DNA or in complex with other transcription factors (Bondestam et al., 2001 [PubMed 12063393]).[supplied by OMIM

면역원

ACVR1C (AAH22530.1, 23 a.a. ~ 112 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SPGLKCVCLLCDSSNFTCQTEGACWASVMLTNGKEQVIKSCVSLPELNAQVFCHSSNNVTKTECCFTDFCNNITLHLPTASPNAPKLGPM

물리적 형태

Solution in phosphate buffered saline, pH 7.4

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable