SAB1402307

Monoclonal Anti-PGK1, (C-terminal) antibody produced in mouse

clone 2H4, purified immunoglobulin, buffered aqueous solution

• 동의어(들): MGC117307, MGC142128, MGC8947, MIG10, PGKA
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: mouse
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 2H4, monoclonal
• 양식: buffered aqueous solution
• 분자량: antigen ~36.41 kDa
• 종 반응성: human
• 기술: capture ELISA: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• 동형: IgG2aκ
• NCBI 수납 번호: NM_000291
• UniProt 수납 번호: P00558
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... PGK1(5230)

설명

일반 설명

The protein encoded by this gene is a glycolytic enzyme that catalyzes the conversion of 1,3-diphosphoglycerate to 3-phosphoglycerate. The encoded protein may also act as a cofactor for polymerase alpha. This gene lies on the X-chromosome, while a related pseudogene also has been found on the X-chromosome and another on chromosome 19. (provided by RefSeq) Phosphoglycerate kinase 1 (PGK1) is a glycolytic enzyme. The gene encoding it is localized on human chromosome X.

면역원

PGK1 (NP_000282, 321 a.a. ~ 417 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SKKYAEAVTRAKQIVWNGPVGVFEWEAFARGTKALMDEVVKATSRGCITIIGGGDTATCCAKWNTEDKVSHVSTGGGASLELLEGKVLPGVDALSNI

생화학적/생리학적 작용

Phosphoglycerate kinase 1 (PGK1) converts 1, 3-diphosphoglycerate to 3-phosphoglycerate. Mitochondrial PGK1 phosphorylates pyruvate dehydrogenase kinase 1. PGK1 may have a role in rheumatoid arthritis. The protein is upregulated in various cancers. It is regulated by hypoxia-inducible factor-1α. It also has a role in DNA repair and angiogenesis. Deficiency of the enzyme is linked to combinations of hemolytic anemia, neurological dysfunction and myopathy.

물리적 형태

Solution in phosphate buffered saline, pH 7.4

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable