HPA018447

Anti-HSCB antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• 동의어(들): Anti-Co-chaperone protein HscB, mitochondrial, Anti-DnaJ homolog subfamily C member 20, Anti-Hsc20
• UNSPSC 코드: 12352203
• 인간 단백질 도해서 번호: HPA018447
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 제품 라인: Prestige Antibodies^® Powered by Atlas Antibodies
• 형태: buffered aqueous glycerol solution
• 종 반응성: human
• 기술: immunohistochemistry: 1:200- 1:500
• 면역원 서열: QFLIEIMEINEKLAEAESEAAMKEIESIVKAKQKEFTDNVSSAFEQDDFEEAKEILTKMRYFSNIEEKIKLKK
• UniProt 수납 번호: Q8IWL3
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... HSCB(150274)

설명

일반 설명

The gene HSCB (iron-sulfur cluster co-chaperone protein HscB, mitochondrial) is mapped to human chromosome 22q12.1. It is expressed in various tissues and is mainly present in the mitochondria. However, small amount of HSCB is also detected outside mitochondria. It contains a conserved amino-terminal J-domain and a less conserved carboxyl-terminal region. It is popularly known as HSC20 (Heat shock cognate 20).

면역원

Co-chaperone protein HscB, mitochondrial Precursor recombinant protein epitope signature tag (PrEST)

애플리케이션

Anti-HSCB antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

생화학적/생리학적 작용

In the biogenesis of iron-sulfur proteins, the final step of iron-sulfur protein assembly involves transfer of an iron-sulfur cluster from a cluster-donor to a cluster-acceptor protein. This process is mediated by a molecular chaperone from the Hsc70 (Heat shock cognate) family and a co-chaperone of the J-domain family. HSCB (Iron-sulfur cluster co-chaperone protein HscB, mitochondrial) is homolog of DnaJ type co-chaperones. It is required for mitochondrial iron-sulfur cluster (ISC) assembly. Depletion of HSCB reduces mitochondrial and cytosolic ISC-containing enzymes. On the other hand, overexpression of HSCB protects cells from oxidative stress. HSCB interacts with iron-sulfur cluster scaffold protein and mitochondrial HSP70 (Heat shock protein).

특징 및 장점

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST74558

물리적 형태

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable