HPA010657

Anti-LMTK2 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• 동의어(들): Anti-AATYK2, Anti-BREK, Anti-KIAA1079, Anti-KPI-2, Anti-KPI2, Anti-LMR2, Anti-PPP1R100, Anti-cprk
• UNSPSC 코드: 12352203
• 인간 단백질 도해서 번호: HPA010657
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 제품 라인: Prestige Antibodies^® Powered by Atlas Antibodies
• 형태: buffered aqueous glycerol solution
• 종 반응성: human
• 기술: immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:200-1:500
• 면역원 서열: MELNGVQADFKPATLSSSLDNPKESVITGHFEKEKPRKIFDSEPLCLSDNLMHQDNFDPLNVQELSENFLFLQEKNLLKGSLSSKEHINDLQTELKNAGFTEAMLETSCRNSLDTELQFAENKPGLSLLQENV
• UniProt 수납 번호: Q8IWU2
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... LMTK2(22853)

설명

일반 설명

LMTK2 (lemur tyrosine kinase 2) contains two transmembrane domains at its N-terminus, a kinase domain and a very long C-terminal tail domain with serine/threonine/tyrosine kinase activity. The gene is mapped to human chromosome 7q21.3.

면역원

Serine/threonine-protein kinase LMTK2 precursor recombinant protein epitope signature tag (PrEST)

애플리케이션

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunofluorescence (1 paper)

생화학적/생리학적 작용

LMTK2 (lemur tyrosine kinase 2) gene encodes a member of the protein tyrosine kinase family. The encoded transmembrane protein binds to the WWY site in the C-terminal tail of myosin-VI. This LMTK2–myosin-VI complex plays a role in endocytic and exocytic membrane trafficking pathways. The complex also regulates tubule formation. The encoded protein also serves a binding partner of the p35-activator subunit for cyclin-dependent kinase 5, of protein phosphatase 1C and its small inhibitor protein 2.

특징 및 장점

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST71447

물리적 형태

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable
• 개인 보호 장비: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)