콘텐츠로 건너뛰기
Merck
모든 사진(6)

Key Documents

HPA001812

Sigma-Aldrich

Anti-APOBEC3G antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

동의어(들):

Anti-APOBEC-related cytidine deaminase antibody produced in rabbit, Anti-APOBEC-related protein antibody produced in rabbit, Anti-ARCD antibody produced in rabbit, Anti-ARP-9 antibody produced in rabbit, Anti-CEM-15 antibody produced in rabbit, Anti-CEM15 antibody produced in rabbit, Anti-DNA dC→dU-editing enzyme APOBEC-3G antibody produced in rabbit

로그인조직 및 계약 가격 보기


About This Item

UNSPSC 코드:
12352203
인간 단백질 도해서 번호:
NACRES:
NA.41

생물학적 소스

rabbit

결합

unconjugated

항체 형태

affinity isolated antibody

항체 생산 유형

primary antibodies

클론

polyclonal

제품 라인

Prestige Antibodies® Powered by Atlas Antibodies

형태

buffered aqueous glycerol solution

종 반응성

human

향상된 검증

orthogonal RNAseq
orthogonal RNAseq
Learn more about Antibody Enhanced Validation

기술

immunohistochemistry: 1:200- 1:500

면역원 서열

MHNDTWVLLNQRRGFLCNQAPHKHGFLEGRHAELCFLDVIPFWKLDLDQDYRVTCFTSWSPCFSCAQEMAKFISKNKHVSLCIFTARIYDDQGRCQEGLRTLAEAGAKISIMTYSEFKHCWDTFVDHQGCPFQPWDGLDEHSQDLSGRL

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

일반 설명

APOBEC3G (apolipoprotein B messenger-RNA-editing enzyme, catalytic polypeptide-like 3G) belongs to the APOBEC family of cytidine deaminases. It is expressed predominantly in cytoplasmic region. It is localized in pyramidal neurons within the gray matter of cerebral and cerebellar cortices. It has a core α-β-α fold structure for catalytic activity. The five-stranded β-sheet is surrounded on both sides by six α-helices arranged over a hydrophobic platform.

면역원

DNA dC→dU-editing enzyme APOBEC-3G recombinant protein epitope signature tag (PrEST)

애플리케이션

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)

생화학적/생리학적 작용

APOBEC3G (apolipoprotein B mRNA editing enzyme catalytic subunit 3G) is associated with diverse biological functions such as mRNA editing, inhibiting the mobilization of retroviruses and retrotransposons, including the inhibition of human immunodeficiency virus-1 (HIV-1) replication. It can restrict HIV-1 infectivity during reverse transcription, by inserting in viral particles and deaminating the viral cDNA cytidines to uridines. The deaminated uridines mutate the DNA strand to generate stop codons for the inactivation of the virus. However, with the help of viral Vif protein HIV-1 can counteracts APOBEC3G by protosomal degradation.

특징 및 장점

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST73531

물리적 형태

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable

개인 보호 장비

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


시험 성적서(COA)

제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Brandon Leonard et al.
Clinical cancer research : an official journal of the American Association for Cancer Research, 22(18), 4746-4755 (2016-03-27)
APOBEC3 DNA cytosine deaminase family members normally defend against viruses and transposons. However, deregulated APOBEC3 activity causes mutations in cancer. Because of broad expression profiles and varying mixtures of normal and cancer cells in tumors, including immune cell infiltration, it
M Sarah Hill et al.
AIDS research and human retroviruses, 22(6), 541-550 (2006-06-27)
The Vif protein of human immunodeficiency virus-1 (HIV-1) has been shown to interact with members of the APOBEC family of cytidine deaminases, particularly APOBEC3G/F. In this study, we isolated RNA from 12 regions of the brain from two pigtailed macaques
Scott G Hansen et al.
Nature, 502(7469), 100-104 (2013-09-13)
Established infections with the human and simian immunodeficiency viruses (HIV and SIV, respectively) are thought to be permanent with even the most effective immune responses and antiretroviral therapies only able to control, but not clear, these infections. Whether the residual
Shivender M D Shandilya et al.
Structure (London, England : 1993), 18(1), 28-38 (2010-02-16)
APOBEC3G is a DNA cytidine deaminase that has antiviral activity against HIV-1 and other pathogenic viruses. In this study the crystal structure of the catalytically active C-terminal domain was determined to 2.25 A. This structure corroborates features previously observed in
Netanya G Sandler et al.
Nature, 511(7511), 601-605 (2014-07-22)
Inflammation in HIV infection is predictive of non-AIDS morbidity and death, higher set point plasma virus load and virus acquisition; thus, therapeutic agents are in development to reduce its causes and consequences. However, inflammation may simultaneously confer both detrimental and

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.