AV39172

Anti-POGZ antibody produced in rabbit

IgG fraction of antiserum

• 동의어(들): Anti-Pogo transposable element with ZNF domain
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: IgG fraction of antiserum
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 형태: buffered aqueous solution
• 분자량: 155 kDa
• 종 반응성: rat, mouse, dog, bovine, rabbit, guinea pig, horse, human
• 농도: 0.5 mg - 1 mg/mL
• 기술: immunohistochemistry: suitable; western blot: suitable
• NCBI 수납 번호: NP_055915
• UniProt 수납 번호: Q7Z3K3
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... POGZ(23126)

설명

일반 설명

POGZ is a zinc-finger protein known to interact with HP1α. Studies have reported that POGZ regulates the dissociation of Aurora B kinase from chromosomal arms during the M phase of the cell cycle.
Rabbit Anti-POGZ antibody recognizes human, mouse, rat, canine, rabbit, and bovine POGZ.

면역원

Synthetic peptide directed towards the N terminal region of human POGZ

애플리케이션

Rabbit Anti-POGZ antibody is suitable for western blot (5.0 μg/ml) and IHC (4-8 μg/ml) applications.

생화학적/생리학적 작용

POGZ appears to be a zinc finger protein containing a transposase domain at the C-terminus. This protein was found to interact with the transcription factor SP1 in a yeast two-hybrid systemThe protein encoded by this gene appears to be a zinc finger protein containing a transposase domain at the C-terminus. This protein was found to interact with the transcription factor SP1 in a yeast two-hybrid system. At least three alternatively spliced transcript variants encoding distinct isoforms have been observed.

서열

Synthetic peptide located within the following region: EELEPWQKISDVIEDSVVEDYNSVDKTTTVSVSQQPVSAPVPIAAHASVA

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable