AV31444
Anti-HOXB5 antibody produced in rabbit
affinity isolated antibody
동의어(들):
Anti-HHO.C10, Anti-HOX2, Anti-HOX2A, Anti-HU-1, Anti-Homeobox B5, Anti-Hox2.1
로그인조직 및 계약 가격 보기
크기 선택
5 ML
289,00 R$
250 ML
397,00 R$
289,00 R$
장바구니에서 구매 가능 여부 확인하기
모든 사진(3)
크기 선택
보기 변경
5 ML
289,00 R$
250 ML
397,00 R$
About This Item
UNSPSC 코드:
12352203
NACRES:
NA.41
289,00 R$
장바구니에서 구매 가능 여부 확인하기
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
양식
buffered aqueous solution
분자량
30 kDa
종 반응성
horse, mouse, bovine, rat, dog, guinea pig, rabbit, human
농도
0.5 mg - 1 mg/mL
1 of 4
이 품목 | 8.43785 | 73747 | W285706 |
|---|---|---|---|
| assay 99% | assay ≥98.0% (GC) | assay ≥97.0% (GC) | assay ≥98% |
| Quality Level 100 | Quality Level 200 | Quality Level 100 | Quality Level 400 |
| form liquid | form liquid | form - | form - |
| refractive index n20/D 1.498 (lit.) | refractive index - | refractive index n20/D 1.498 (lit.) | refractive index n20/D 1.498 (lit.) |
| density 1.032 g/mL at 25 °C (lit.) | density 1.03 g/cm3 at 20 °C | density 1.032 g/mL at 25 °C (lit.) | density 1.032 g/mL at 25 °C (lit.) |
| bp 238-239 °C (lit.) | bp 212 °C/1013 hPa | bp 238-239 °C (lit.) | bp 238-239 °C (lit.) |
일반 설명
면역원
Synthetic peptide directed towards the N terminal region of human HOXB5
애플리케이션
Rabbit Anti-HOXB5 antibody can be used for western blot applications at 0.5μg/ml.
생화학적/생리학적 작용
HOXB5 belongs to the homeobox family. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXB genes located in a cluster on chromosome 17. The exact role of this gene has yet to be determined.This gene is a member of the Antp homeobox family and encodes a nuclear protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded protein functions as a sequence-specific transcription factor that is involved in lung and gut development. Increased expression of this gene is associated with a distinct biologic subset of acute myeloid leukemia (AML) and the occurrence of bronchopulmonary sequestration (BPS) and congenital cystic adenomatoid malformation (CCAM) tissue.
서열
Synthetic peptide located within the following region: MSSYFVNSFSGRYPNGPDYQLLNYGSGSSLSGSYRDPAAMHTGSYGYNYN
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
이 페이지에는 기계 번역된 텍스트가 포함되어 있습니다.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
Yaxu Wu et al.
Molecular and cellular biology, 23(16), 5680-5691 (2003-08-05)
Endothelial cells differentiate from mesoderm-derived precursors to initiate the earliest events in vascular development. Although the signaling events that regulate the successive steps of vascular development are known in some detail, the transcriptional processes that regulate the first steps in
Ming Fu et al.
Developmental dynamics : an official publication of the American Association of Anatomists, 228(1), 1-10 (2003-09-02)
HOX genes from paralogous groups 4 and 5 are particularly relevant to the gut neuromusculature development because these genes are expressed at the splanchnic mesoderm surrounding the gut diverticulum, and at the level of the neural tube from where the
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.
