AV31444

Anti-HOXB5 antibody produced in rabbit

affinity isolated antibody

• 동의어(들): Anti-HHO.C10, Anti-HOX2, Anti-HOX2A, Anti-HU-1, Anti-Homeobox B5, Anti-Hox2.1
• UNSPSC 코드: 12352203
• NACRES: NA.41
• 클론: polyclonal
• application: IHC; WB
• 종 반응성: horse, mouse, bovine, rat, dog, guinea pig, rabbit, human
• 기술: immunohistochemistry: suitable; western blot: suitable
• citations: 2

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 양식: buffered aqueous solution
• 분자량: 30 kDa
• 종 반응성: horse, mouse, bovine, rat, dog, guinea pig, rabbit, human
• 농도: 0.5 mg - 1 mg/mL
• 기술: immunohistochemistry: suitable; western blot: suitable
• NCBI 수납 번호: NP_002138
• UniProt 수납 번호: P09067
• 배송 상태: wet ice
• 저장 온도: −20°C
• 유전자 정보: human ... HOXB5(3215)

설명

일반 설명

HOXB5 is known to regulate the development of gut neural crest cells in human embryos. It is also known to function as a transcriptional switch for vascular endothelial cell differentiation.
Rabbit Anti-HOXB5 antibody binds to canine, human, mouse, and rat HOXB5.

면역원

Synthetic peptide directed towards the N terminal region of human HOXB5

애플리케이션

Rabbit Anti-HOXB5 antibody can be used for western blot applications at 0.5μg/ml.

생화학적/생리학적 작용

HOXB5 belongs to the homeobox family. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXB genes located in a cluster on chromosome 17. The exact role of this gene has yet to be determined.This gene is a member of the Antp homeobox family and encodes a nuclear protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded protein functions as a sequence-specific transcription factor that is involved in lung and gut development. Increased expression of this gene is associated with a distinct biologic subset of acute myeloid leukemia (AML) and the occurrence of bronchopulmonary sequestration (BPS) and congenital cystic adenomatoid malformation (CCAM) tissue.

서열

Synthetic peptide located within the following region: MSSYFVNSFSGRYPNGPDYQLLNYGSGSSLSGSYRDPAAMHTGSYGYNYN

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable