AV46418
Anti-TMPRSS11D antibody produced in rabbit
IgG fraction of antiserum
Synonym(s):
Anti-HAT, Anti-MGC150587, Anti-MGC150588, Anti-Transmembrane protease, serine 11D
Sign Into View Organizational & Contract Pricing
All Photos(2)
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
Recommended Products
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
IgG fraction of antiserum
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
46 kDa
species reactivity
human
concentration
0.5 mg - 1 mg/mL
technique(s)
immunohistochemistry: suitable
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... TMPRSS11D(9407)
Immunogen
Synthetic peptide directed towards the N terminal region of human TMPRSS11D
Application
Anti-TMPRSS11D antibody produced in rabbit is suitable for western blotting at a concentration of 2.5μg/ml. It is also useful for immunohistochemistry at a concentration of 4-8μg/ml.
Biochem/physiol Actions
TMPRSS11D (transmembrane protease, serine 11D) gene also referred to as MGC150587, MGC150588 or HAT(human airway trypsin-like protease) encodes for a 418 amino acid containing type II integral membrane protein. HAT stimulates amphiregulin (AR) production via protease-activated receptor-2 (PAR-2) mediated ERK pathway and then releases it by TACE (tumor necrosis factor alpha-converting enzyme)-dependent mechanism. HAT also activates the PAR-2 and assists in regulating the cellular functions of human bronchial epithelial cells (HBEC). Additionally, it induces the fibroblast proliferation in bronchial airways by mediating the PAR-2-dependent MEK-MAPK pathway.
Sequence
Synthetic peptide located within the following region: RSSFQLLNVEYNSQLNSPATQEYRTLSGRIESLITKTFKESNLRNQFIRA
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Rie Matsushima et al.
American journal of physiology. Lung cellular and molecular physiology, 290(2), L385-L395 (2005-10-04)
Human airway trypsin-like protease (HAT) was isolated from airway secretions and localized to bronchial epithelial cells by immunohistochemistry. In the present study, we examined whether HAT could stimulate DNA synthesis and proliferation of primary human bronchial fibroblasts (HBF). HAT significantly
Manabu Chokki et al.
The FEBS journal, 272(24), 6387-6399 (2005-12-13)
Human airway trypsin-like protease (HAT), a serine protease found in the sputum of patients with chronic airway diseases, is an agonist of protease-activated receptor-2 (PAR-2). Previous results have shown that HAT enhances the release of amphiregulin (AR); further, it causes
Mari Miki et al.
The journal of medical investigation : JMI, 50(1-2), 95-107 (2003-03-13)
It has been shown that human airway trypsin-like protease (HAT) is localized in human bronchial epithelial cells (HBEC), and trypsin activates protease-activated receptor-2 (PAR-2). Activation of PAR-2 activates G-protein followed by an increase of intracellular free Ca2+, [Ca2+]in. This study
Jee Hyun Kim et al.
Yonsei medical journal, 55(5), 1333-1340 (2014-07-23)
The aim of this work was to evaluate nuclear histone acetylation level and total histone acetyltransferase (HAT) and deacetylase (HDAC) activity in ejaculated sperm and their relevance to conventional sperm parameters. Thirty-three normozoospermic men were included in this study. Semen
F Wang et al.
Neurological research, 36(3), 224-233 (2014-02-12)
The herbal extract 3-n-butylphthalide (NBP) is used in clinical practice for ischemic patients in China. It has been shown to have various neuroprotective effects both in vitro and in vivo. In the present study, the effects of NBP on learning
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service