Skip to Content
Merck
All Photos(1)

Key Documents

Safety Information

APREST94161

Sigma-Aldrich

PrEST Antigen TRHR

Prestige Antigens Powered by Atlas Antibodies

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203

recombinant

expressed in E. coli

Assay

>80% (SDS-PAGE)

form

buffered aqueous solution

mol wt

predicted mol wt 23 kDa

purified by

immobilized metal affinity chromatography (IMAC)

concentration

≥0.5 mg/mL

immunogen sequence

ILFLNPIPSDPKENSKTWKNDSTHQNTNLNVNTSNRCFNSTVSSRKQVTK

Ensembl | human accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... TRHR(7201)

General description

Recombinant protein fragment of Human TRHR with N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag

Application

Blocking agent and positive assay control using corresponding antibodies.

Physical form

Solution in phosphate-buffered saline and 1M Urea, pH 7.4

Preparation Note

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Storage Class Code

10 - Combustible liquids

WGK

WGK 2

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Regulatory Listings

Regulatory Listings are mainly provided for chemical products. Only limited information can be provided here for non-chemical products. No entry means none of the components are listed. It is the user’s obligation to ensure the safe and legal use of the product.

JAN Code

APREST94161-100UL:


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service