WH0011074M3

Monoclonal Anti-TRIM31 antibody produced in mouse

clone 2G11, purified immunoglobulin, buffered aqueous solution

• Sinonimo/i: Anti-C6orf13, Anti-HCG1, Anti-HCGI, Anti-RNF, Anti-tripartite motif-containing 31
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: mouse
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: purified immunoglobulin
• Tipo di anticorpo: primary antibodies
• Clone: 2G11, monoclonal
• Forma fisica: buffered aqueous solution
• Reattività contro le specie: human
• tecniche: immunofluorescence: suitable; indirect ELISA: suitable
• Isotipo: IgG2aκ
• N° accesso Genebanck: NM_007028
• N° accesso UniProt: Q9BZY9
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... TRIM31(11074)

Descrizione

Descrizione generale

TRIM31 (tripartite motif-containing 31) belongs to TRIM (tripartite motif-containing protein) family. It is particularly expressed in the gastrointestinal tract. TRIM31 contains carboxy-terminal PRY and SPRY (spla kinase and ryanodine receptor) domains. It is usually located in the cytoplasm, but a fraction of TRIM31 is present in the mitochondria. TRIM31 is located on human chromosome 6p22.1.

Immunogeno

TRIM31 (NP_008959, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MASGQFVNKLQEEVICPICLDILQKPVTIDCGHNFCLKCITQIGETSCGFFKCPLCKTSVRKNAIRFNSLLRNLVEKIQALQASEVQSKRKEATCPRHQE

Azioni biochim/fisiol

Overexpression of TRIM31 (tripartite motif-containing 31) suppresses anchorage-independent cell growth generated by the active form of c-Src. It is expected to play a major role in gastrointestinal tissue-specific regulation of cell proliferation.

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Note legali

GenBank is a registered trademark of United States Department of Health and Human Services

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable
• Dispositivi di protezione individuale: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)