SAB2108687

Anti-LYCAT

affinity isolated antibody

• Sinonimo/i: Anti- AGPAT8, Anti- FLJ37965, Anti- LYCAT, Anti- UNQ1849, Anti-ALCAT1
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Forma fisica: buffered aqueous solution
• PM: 44 kDa
• Reattività contro le specie: human, rabbit
• Concentrazione: 0.5-1 mg/mL
• tecniche: immunoblotting: suitable
• Numero d’accesso: NM_001002257
• N° accesso UniProt: Q6UWP7
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... LYCAT(253558)

Descrizione

Immunogeno

Synthetic peptide directed towards the middle region of human LYCAT

Azioni biochim/fisiol

LYCAT is an acyl-CoA:lysocardiolipin acyltransferase. It possesses both lysophosphatidylinositol acyltransferase (LPIAT) and lysophosphatidylglycerol acyltransferase (LPGAT) activities. LYCAT recognizes both monolysocardiolipin and dilysocardiolipin as substrates with a preference for linoleoyl-CoA and oleoyl-CoA as acyl donors. LYCAT acts as a remodeling enzyme for cardiolipin, a major membrane polyglycerophospholipid. It converts lysophosphatidic acid (LPA) into phosphatidic acid (PA) with a relatively low activity. LYCAT is required for establishment of the hematopoietic and endothelial lineages.

Sequenza

Synthetic peptide located within the following region: YLYSLVKWYFIITIVIFVLQERIFGGLEIIELACYRLLHKQPHLNSKKNE

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable