SAB2102610

Anti-TUT1 antibody produced in rabbit

affinity isolated antibody

• Sinonimo/i: Anti-FLJ21850, Anti-FLJ22267, Anti-FLJ22347, Anti-MGC131987, Anti-Terminal uridylyl transferase 1, U6 snRNA-specific
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Forma fisica: buffered aqueous solution
• PM: 94 kDa
• Reattività contro le specie: guinea pig, bovine, human, horse, dog
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: western blot: suitable
• N° accesso UniProt: Q9H6E5
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... TUT1(64852)

Descrizione

Descrizione generale

The previously assigned protein identifier A8K995 has been merged into Q9H6E5. Full details can be found on the UniProt database.

Immunogeno

Synthetic peptide directed towards the N terminal region of human TUT1

Azioni biochim/fisiol

TUT1 is a nucleotidyl transferase that functions as both a terminal uridylyltransferase and a nuclear poly(A) polymerase. TUT1 specifically adds and removes nucleotides from the 3′ end of small nuclear RNAs and select mRNAs and may function in controlling gene expression and cell proliferation.TUT1 specifically catalyzes uridylylation of U6 snRNA (RNU6; MIM 180692) and is essential for cell proliferation (Trippe et al., 2006 [PubMed 16790842]).[supplied by OMIM].

Sequenza

Synthetic peptide located within the following region: CDLDLFLDLGDLEEPQPVPKAPESPSLDSALASPLDPQALACTPASPPDS

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable