Passa al contenuto
Merck
Tutte le immagini(1)

Key Documents

AV54366

Sigma-Aldrich

Anti-IMPDH2 antibody produced in rabbit

affinity isolated antibody

Sinonimo/i:

Anti-IMP (inosine monophosphate) dehydrogenase 2, Anti-IMPD2, Anti-IMPDH-II

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
Tutte le immagini(1)

About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

rabbit

Livello qualitativo

100

Coniugato

unconjugated

Forma dell’anticorpo

affinity isolated antibody

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Forma fisica

buffered aqueous solution

PM

56 kDa

Reattività contro le specie

guinea pig, rabbit, bovine, horse, mouse, rat, human, dog

Concentrazione

0.5 mg - 1 mg/mL

tecniche

western blot: suitable

N° accesso NCBI

NP_000875

N° accesso UniProt

P12268

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... IMPDH2(3615)

Immunogeno

Synthetic peptide directed towards the C terminal region of human IMPDH2

Applicazioni

Anti-IMPDH2 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.

Azioni biochim/fisiol

IMPDH2 gene encodes the rate-limiting enzyme inosine monophosphate dehydrogenase 2. It consists of 14 exons and is approximately 5.8kb in length. It is localised in the cytoplasm and nucleus. It plays a pivotal role in catalysing the NAD-dependent oxidation of inosine-5′-monophosphate into xanthine-5′-monophosphate, later converted to guanosine-5′-monophosphate. A novel non-genotoxic p53 activator Inauzhin (INZ) inhibits cellular activity of IMPDH2, which in turn reduces the levels of cellular GTP and GTP-binding nucleostemin. INZ also induces the ribosomal stress (RS)-p53 pathway and RPL11/RPL5-MDM2 interaction and activates p53 and inhibits cancer cell growth.

Sequenza

Synthetic peptide located within the following region: SCQDIGAKSLTQVRAMMYSGELKFEKRTSSAQVEGGVHSLHSYEKRLF

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Certificati d'analisi (COA)

Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Qi Zhang et al.
eLife, 3, doi:10-doi:10 (2014-10-28)
The 'ribosomal stress (RS)-p53 pathway' is triggered by any stressor or genetic alteration that disrupts ribosomal biogenesis, and mediated by several ribosomal proteins (RPs), such as RPL11 and RPL5, which inhibit MDM2 and activate p53. Inosine monophosphate (IMP) dehydrogenase 2
Jeremy E McLean et al.
The Biochemical journal, 379(Pt 2), 243-251 (2004-02-10)
Inosine 5'-monophosphate dehydrogenase (IMPDH) is the rate-limiting enzyme in the de novo biosynthesis of guanine nucleotides. In addition to the catalytic domain, IMPDH contains a subdomain of unknown function composed of two cystathione beta-synthase domains. Our results, using three different
A G Zimmermann et al.
The Journal of biological chemistry, 270(12), 6808-6814 (1995-03-24)
Inosine-5'-monophosphate dehydrogenase (IMPDH) activity and mRNA levels are induced up to 15-fold upon mitogenic or antigenic stimulation of human peripheral blood T lymphocytes. This increase in IMPDH activity is required for cellular proliferation and has been associated with malignant transformation.
L Zhou et al.
Clinical & translational oncology : official publication of the Federation of Spanish Oncology Societies and of the National Cancer Institute of Mexico, 16(10), 906-913 (2014-03-25)
Our previous study showed the upregulation of inosine 5'-monophosphate dehydrogenase type II (IMPDH2) protein in human prostate cancer (PCa) tissues and sera compared to non-cancerous controls by proteomics and ELISA analyses. However, the clinical significance of IMPDH2 in PCa has

Articoli

Nucleotide Synthesis in Cancer Cells

Neoplastic cells are highly dependent on the de novo synthesis of nucleotides to maintain sufficient pools to support DNA replication and the production of RNA.

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.