AV44289
Anti-PSEN2 antibody produced in rabbit
affinity isolated antibody
Sinonimo/i:
Anti-AD3L, Anti-AD4, Anti-PS2, Anti-Presenilin 2 (Alzheimer disease 4), Anti-STM2
Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
About This Item
Codice UNSPSC:
12352203
NACRES:
NA.41
Prodotti consigliati
Origine biologica
rabbit
Livello qualitativo
Coniugato
unconjugated
Forma dell’anticorpo
affinity isolated antibody
Tipo di anticorpo
primary antibodies
Clone
polyclonal
Forma fisica
buffered aqueous solution
PM
49 kDa
Reattività contro le specie
bovine, horse, human, dog, rat, guinea pig, rabbit, mouse
Concentrazione
0.5 mg - 1 mg/mL
tecniche
immunohistochemistry: suitable
western blot: suitable
N° accesso NCBI
N° accesso UniProt
Condizioni di spedizione
wet ice
Temperatura di conservazione
−20°C
modifica post-traduzionali bersaglio
unmodified
Informazioni sul gene
human ... PSEN2(5664)
Immunogeno
Synthetic peptide directed towards the N terminal region of human PSEN2
Applicazioni
Anti-PSEN2 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml and for immunohistochemistry of paraffin-embedded tissue sections at a concentration of 4-8μg/ml.
Azioni biochim/fisiol
Presenilin 2 (PSEN2; PS2; AD4) regulates the activity of γ-secretase, the enzyme that cleaves amyloid precursor protein (APP). Studies indicate that PSEN2 also might regulate the cleavage of Notch receptor that in turn regulates gamma-secretase activity. Presenilins regulate the release of neurotransmitters at the synapses and intracellular Ca+2 homeostasis. Mutations in gene encoding presenilins are linked to familial Alzheimer′s disease.
Sequenza
Synthetic peptide located within the following region: VVVATIKSVRFYTEKNGQLIYTPFTEDTPSVGQRLLNSVLNTLIMISVIV
Stato fisico
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Esclusione di responsabilità
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Motore di ricerca dei prodotti.
Codice della classe di stoccaggio
10 - Combustible liquids
Classe di pericolosità dell'acqua (WGK)
WGK 3
Punto d’infiammabilità (°F)
Not applicable
Punto d’infiammabilità (°C)
Not applicable
Certificati d'analisi (COA)
Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.
Possiedi già questo prodotto?
I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.
Bei Wu et al.
Proceedings of the National Academy of Sciences of the United States of America, 110(37), 15091-15096 (2013-08-07)
Presenilin (PS) plays a central role in the pathogenesis of Alzheimer's disease, and loss of PS causes progressive memory impairment and age-related neurodegeneration in the mouse cerebral cortex. In hippocampal neurons, PS is essential for neurotransmitter release, NMDA receptor-mediated responses
Xike Qin et al.
The American journal of pathology, 187(8), 1828-1847 (2017-06-24)
A sporadic form of Alzheimer disease (AD) and vascular dementia share many risk factors, and their pathogenic mechanisms are suggested to be related. Transcription factor early growth response 1 (Egr-1) regulates various vascular pathologies and is up-regulated in both AD
Bruno A Benitez et al.
PLoS genetics, 9(8), e1003685-e1003685 (2013-08-31)
The primary constituents of plaques (Aβ42/Aβ40) and neurofibrillary tangles (tau and phosphorylated forms of tau [ptau]) are the current leading diagnostic and prognostic cerebrospinal fluid (CSF) biomarkers for AD. In this study, we performed deep sequencing of APP, PSEN1, PSEN2
Andrea Pilotto et al.
BioMed research international, 2013, 689591-689591 (2014-01-01)
The discovery of monogenic forms of Alzheimer's Disease (AD) associated with mutations within PSEN1, PSEN2, and APP genes is giving a big contribution in the understanding of the underpinning mechanisms of this complex disorder. Compared with sporadic form, the phenotype
Tomoko Wakabayashi et al.
Physiology (Bethesda, Md.), 23, 194-204 (2008-08-14)
The presenilins in combination with other proteins generate different gamma-secretases, which are involved in the regulated intramembrane proteolysis of a variety of proteins. Understanding the specificity and regulation of these proteases will potentially lead to novel therapeutics for Alzheimer's disease
Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..
Contatta l'Assistenza Tecnica.