Passa al contenuto
Merck
Tutte le immagini(1)

Documenti fondamentali

AV44048

Sigma-Aldrich

Anti-SLC2A10 antibody produced in rabbit

IgG fraction of antiserum

Sinonimo/i:

Anti-GLUT10, Anti-Solute carrier family 2 (facilitated glucose transporter), member 10

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

rabbit

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

IgG fraction of antiserum

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Stato

buffered aqueous solution

PM

60 kDa

Reattività contro le specie

human

Concentrazione

0.5 mg - 1 mg/mL

tecniche

western blot: suitable

N° accesso NCBI

N° accesso UniProt

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... SLC2A10(81031)

Immunogeno

Synthetic peptide directed towards the middle region of human SLC2A10

Applicazioni

Anti-SLC2A10 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5μg/ml.

Azioni biochim/fisiol

SLC2A10 (GLUT10) is a facilitative glucose transporter that regulates glucose homeostasis. The activity of GLUT10 is essential for developmental regulation by TGF-β, cardiovascular development, mitochondrial respiration and metabolism. Polymorphisms in the gene encoding this protein have been observed in Caucasian Americans with type 2 diabetes and in patients with arterial tortuosity syndrome.

Sequenza

Synthetic peptide located within the following region: AKKTKPHPRSGDPSAPPRLALSSALPGPPLPARGHALLRWTALLCLMVFV

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Jennifer L Bento et al.
BMC medical genetics, 6, 42-42 (2005-12-13)
GLUT10 (gene symbol SLC2A10) is a facilitative glucose transporter within the type 2 diabetes (T2DM)-linked region on chromosome 20q12-13.1. Therefore, we evaluated GLUT10 as a positional candidate gene for T2DM in Caucasian Americans. Twenty SNPs including 4 coding, 10 intronic
Andy Willaert et al.
Human molecular genetics, 21(6), 1248-1259 (2011-11-26)
Growth factor signaling results in dramatic phenotypic changes in cells, which require commensurate alterations in cellular metabolism. Mutations in SLC2A10/GLUT10, a member of the facilitative glucose transporter family, are associated with altered transforming growth factor-β (TGFβ) signaling in patients with

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.