Passa al contenuto
Merck
Tutte le immagini(2)

Documenti fondamentali

860381P

Avanti

14:0 PG-d54

Avanti Research - A Croda Brand 860381P, powder

Sinonimo/i:

1,2-dimyristoyl-d54-sn-glycero-3-[phospho-rac-(1-glycerol)] (sodium salt)

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Formula empirica (notazione di Hill):
C34H12O10PNaD54
Numero CAS:
Peso molecolare:
743.18
Numero MDL:
Codice UNSPSC:
12352100
NACRES:
NA.25

Saggio

>99% (TLC)

Stato

powder

Confezionamento

pkg of 1 × 10 mg (860381P-10mg)
pkg of 1 × 100 mg (860381P-100mg)

Produttore/marchio commerciale

Avanti Research - A Croda Brand 860381P

Condizioni di spedizione

dry ice

Temperatura di conservazione

−20°C

Stringa SMILE

[H][C@@](COP([O-])(OCC(O)CO)=O)(OC(C([2H])([2H])C([2H])([2H])C([2H])([2H])C([2H])([2H])C([2H])([2H])C([2H])([2H])C([2H])([2H])C([2H])([2H])C([2H])([2H])C([2H])([2H])C([2H])([2H])C([2H])([2H])C([2H])([2H])[2H])=O)COC(C([2H])([2H])C([2H])([2H])C([2H])([2H])

Categorie correlate

Descrizione generale

14:0 PG-d54 is a deuterated phosphoglycerol (PG) wherein 54 protons of dimyristoyl are replaced by deuterium.
Deuterated fatty acids experience exchange of the deuteriums on the alpha carbon to the carbonyl, i.e., C2 position, and will therefore be a mixture of compounds that are fully deuterated and partially deuterated at that position.

Applicazioni

14:0 PG-d54 may be used to study the unspecific interaction of a phospholipid membrane with endotoxins.

Confezionamento

5 mL Amber Glass Screw Cap Vial (860381P-100mg)
5 mL Amber Glass Screw Cap Vial (860381P-10mg)

Note legali

Avanti Research is a trademark of Avanti Polar Lipids, LLC

Codice della classe di stoccaggio

11 - Combustible Solids

Classe di pericolosità dell'acqua (WGK)

WGK 3


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

It looks like we've run into a problem, but you can still download Certificates of Analysis from our Documenti section.

Se ti serve aiuto, non esitare a contattarci Servizio Clienti

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Lipopolysaccharide-binding protein-mediated interaction of lipid A from different origin with phospholipid membranes Invited Lecture
Gutsmann T, et al.
Physical Chemistry Chemical Physics, 2(20), 4521-4528 (2000)
Randi Nordström et al.
Journal of colloid and interface science, 562, 322-332 (2019-12-20)
In the present study, lipid membrane interactions of anionic poly(ethyl acrylate-co-methacrylic acid) (MAA) microgels as carriers for the cationic antimicrobial peptide LL-37 ([LL-37, 37 aa]) were investigated. In doing so, neutron reflectometry (NR), Fourier-transform infrared spectroscopy with attenuated total reflection (FTIR-ATR), zeta
Chris Miranda et al.
Langmuir : the ACS journal of surfaces and colloids, 34(39), 11759-11771 (2018-09-11)
SP-B63-78, a lung surfactant protein fragment, and magainin 2, an antimicrobial peptide, are amphipathic peptides with the same overall charge but different biological functions. Deuterium nuclear magnetic resonance has been used to compare the interactions of these peptides with dispersions
Nicole Harmouche et al.
Biophysical journal, 115(6), 1033-1044 (2018-09-10)
A synergistic enhancement of activities has been described for the amphipathic cationic antimicrobial peptides magainin 2 and PGLa when tested in antimicrobial assays or in biophysical experiments using model membranes. In the presence of magainin 2, PGLa changes from an

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.