Skip to Content
Merck
All Photos(5)

Documents

SAB2101847

Sigma-Aldrich

Anti-POSTN antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-MGC119510, Anti-MGC119511, Anti-OSF-2, Anti-PDLPOSTN, Anti-Periostin, osteoblast specific factor

Sign Into View Organizational & Contract Pricing
All Photos(5)

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

100

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

93 kDa

species reactivity

dog, mouse, human, pig, bovine

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

UniProt accession no.

Q15063

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... POSTN(10631)

Immunogen

Synthetic peptide directed towards the middle region of human POSTN

Biochem/physiol Actions

POSTN binds to heparin. It induces cell attachment and spreading and plays a role in cell adhesion. POSTN may play a role in extracellular matrix mineralization.

Sequence

Synthetic peptide located within the following region: VTKFIEGGDGHLFEDEEIKRLLQGDTPVRKLQANKKVQGSRRRLREGRSQ

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Buxian Tian et al.
Tumour biology : the journal of the International Society for Oncodevelopmental Biology and Medicine, 35(6), 5877-5883 (2014-04-11)
The objective of this study is to investigate the expression level of periostin in cancer stem cells as well as in the glioma tissues and the relationship between periostin expression and clinical and pathological characteristics and prognosis of gliomas. ESA+/CD133+/lin-
Munehisa Shimamura et al.
Hypertension research : official journal of the Japanese Society of Hypertension, 37(6), 494-499 (2014-03-22)
Periostin is an extracellular matrix glycoprotein and has various cellular effects. Previously, we demonstrated the neuroprotective effects of periostin during the acute stage of cerebral ischemia. However, its expression during the chronic stage remains unknown. Herein, we examined the expression
Zheyu Wang et al.
Nature biomedical engineering, 5(1), 64-76 (2021-01-24)
The detection and quantification of protein biomarkers in interstitial fluid is hampered by challenges in its sampling and analysis. Here we report the use of a microneedle patch for fast in vivo sampling and on-needle quantification of target protein biomarkers
Jie Chen et al.
Journal of cellular physiology, 229(11), 1647-1659 (2014-03-13)
Hertwig's epithelial root sheath (HERS) cells participate in cementum formation through epithelial-mesenchymal transition (EMT). Previous studies have shown that transforming growth factor beta 1 (TGF-β1) and fibroblast growth factor 2 (FGF2) are involved in inducing EMT. However, their involvement in

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service