HPA012750

Anti-HLA-DMA antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonyme(s) : Anti-AL662845.5, Anti-HLA class II histocompatibility antigen, DM alpha chain precursor, Anti-MHC class II antigen DMA
• Code UNSPSC : 12352203
• Numéro HPA (Human Protein Atlas): HPA012750

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Gamme de produits: Prestige Antibodies^® Powered by Atlas Antibodies
• Forme: buffered aqueous glycerol solution
• Espèces réactives: human
• Validation améliorée: orthogonal RNAseq; recombinant expression; Learn more about Antibody Enhanced Validation
• Technique(s): immunoblotting: 0.04-0.4 μg/mL; immunohistochemistry: 1:50-1:200
• Séquence immunogène: PTPMWPDDLQNHTFLHTVYCQDGSPSVGLSEAYDEDQLFFFDFSQNTRVPRLPEFADWAQEQGDAPAILFDKEFCEWMIQQIGPKLDGKIPVSRGFPIAEV
• Numéro d'accès UniProt: P28067
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... HLA-DMA(3108)

Description

Description générale

HLA class II histocompatibility antigen, DM α chain (HLA-DMA) is a membrane-anchored heterodimeric protein that belongs to the family of proteins with a major histocompatibility (MHC) fold. It contains a peptide-binding site which is altered to an almost fully closed groove-like structure.

Immunogène

HLA class II histocompatibility antigen, DM alpha chain precursor recombinant protein epitope signature tag (PrEST)

Application

Anti-HLA-DMA antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Actions biochimiques/physiologiques

HLA class II histocompatibility antigen, DM α chain (HLA-DMA) is majorly involved in antigen presentation to cluster of differentiation-4 (CD4) T-cells. It catalyzes the release of class II-associated invariant chain-derived peptides (CLIP) from class II histocompatibility molecules which are newly synthesized. It has a peptide exchange activity and functions as a chaperone to peptide-free class II major histocompatibility (MHC) molecules. HLA-DMA binds to class II molecules, like HLA-DR for catalysis and the inhibitor HLA-DO.

Caractéristiques et avantages

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST71880

Forme physique

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable
• Équipement de protection individuelle: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)