HPA001275

Anti-HIF1A antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonyme(s) : Anti-ARNT-interacting protein antibody produced in rabbit, Anti-Basic-helix-loop-helix-PAS protein MOP1 antibody produced in rabbit, Anti-HIF-1 α antibody produced in rabbit, Anti-HIF1 α antibody produced in rabbit, Anti-Hypoxia-inducible factor 1 α antibody produced in rabbit, Anti-Member of PAS protein 1 antibody produced in rabbit
• Numéro MDL: MFCD01633488
• Code UNSPSC : 12352203
• Numéro HPA (Human Protein Atlas): HPA001275
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Gamme de produits: Prestige Antibodies^® Powered by Atlas Antibodies
• Forme: buffered aqueous glycerol solution
• Espèces réactives: human
• Technique(s): immunohistochemistry: 1:200- 1:500
• Séquence immunogène: KSHPRSPNVLSVALSQRTTVPEEELNPKILALQNAQRKRKMEHDGSLFQAVGIGTLLQQPDDHAATTSLSWKRVKGCKSSEQNGMEQKTIILIPSDLACRLLGQSMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALD
• Numéro d'accès UniProt: Q16665
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... HIF1A(3091)

Description

Description générale

The gene encoding HIF1A (hypoxia inducible factor 1 subunit α) is localized on human chromosome 14q23.2. It is part of the HIF-1 heterodimer complex and is modulated by oxygen.

Immunogène

Hypoxia-inducible factor 1 α recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Rabbit polyclonal anti-HIF1A antibody is used to tag hypoxia-inducible factor 1 α for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques such as immunoblotting, immunoprecipitation, and immunofluorescence. It is used as a probe to determine the presence and roles of hypoxia-inducible factor 1 α in the structure and function of hypoxia-inducible factor 1.

Actions biochimiques/physiologiques

Hypoxia-inducible factor 1, α subunit (HIF1A) combines with aryl hydrocarbon receptor nuclear translocator (Arnt, HIF1B), the β subunit to create the heterodimeric basic helix-loop-helix transcription factor hypoxia-inducible factor 1. Many hypoxia-regulated genes are mediated by the hypoxia-inducible factor 1 (HIF-1) complex. HIF-1 binds to the promoter of hypoxia-responsive genes and other transcription factors, such as p300, signal and transducer of transcription 3, and redox effector factor 1/apurinic/apyrimidinic endonuclease.

Caractéristiques et avantages

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST70506

Forme physique

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable
• Équipement de protection individuelle: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)