AV32533
Anti-SPDEF (AB1) antibody produced in rabbit
affinity isolated antibody
Synonyme(s) :
Spdef Antibody, Spdef Antibody - Anti-SPDEF (AB1) antibody produced in rabbit, Anti-PDEF, Anti-RP11-375E1__A.3, Anti-SAM pointed domain containing ets transcription factor, Anti-bA375E1.3
Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
About This Item
Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41
Produits recommandés
Source biologique
rabbit
Niveau de qualité
Conjugué
unconjugated
Forme d'anticorps
affinity isolated antibody
Type de produit anticorps
primary antibodies
Clone
polyclonal
Forme
buffered aqueous solution
Poids mol.
37 kDa
Espèces réactives
bovine, rabbit, human, dog, guinea pig
Concentration
0.5 mg - 1 mg/mL
Technique(s)
western blot: suitable
Numéro d'accès NCBI
Numéro d'accès UniProt
Conditions d'expédition
wet ice
Température de stockage
−20°C
Modification post-traductionnelle de la cible
unmodified
Informations sur le gène
human ... SPDEF(25803)
Catégories apparentées
Description générale
Rabbit polyclonal anti-SPDEF (AB1) antibody reacts with human, mouse, rat, bovine, pig, and canine SAM pointed domain containing ets transcription factors.
SAM pointed domain containing ets transcription factor (SPDEF, PDEF) is involved in the regulation of terminal differentiation of goblet/Paneth progenitor cells into intestinal Paneth and goblet cells. SPDEF plays a critical role in regulating a transcriptional network mediating IL-13-induced MUC5AC synthesis dependent on STAT6.
SPDEF suppresses the metastasis of prostate cancer and modulates goblet cell hyperplasia in airway epithelial cells.
Rabbit Anti-SPDEF (AB1) antibody recognizes human, mouse, rat, bovine, pig, and canine SPDEF.
Rabbit Anti-SPDEF (AB1) antibody recognizes human, mouse, rat, bovine, pig, and canine SPDEF.
Immunogène
Synthetic peptide directed towards the middle region of human SPDEF
Application
Rabbit Anti-SPDEF (AB1) antibody can be used for western blot applications at a concentration of 1μg/ml.
Rabbit polyclonal anti-SPDEF (AB1) antibody is used to tag SAM pointed domain containing ets transcription factor for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of SAM pointed domain containing ets transcription factor in the differentiation of Paneth and goblet cells and mucin production.
Actions biochimiques/physiologiques
PDEF is an ETS transcription factor expressed in prostate epithelial cells. It acts as an androgen-independent transactivator of PSA expression.PDEF is an ETS transcription factor expressed in prostate epithelial cells. It acts as an androgen-independent transactivator of PSA (MIM 176820) expression.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Séquence
Synthetic peptide located within the following region: ELCAMSEEQFRQRSPLGGDVLHAHLDIWKSAAWMKERTSPGAIHYCASTS
Forme physique
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clause de non-responsabilité
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Vous ne trouvez pas le bon produit ?
Essayez notre Outil de sélection de produits.
Code de la classe de stockage
10 - Combustible liquids
Classe de danger pour l'eau (WGK)
WGK 3
Point d'éclair (°F)
Not applicable
Point d'éclair (°C)
Not applicable
Certificats d'analyse (COA)
Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".
Déjà en possession de ce produit ?
Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.
Giuseppe Lo Sasso et al.
PloS one, 9(7), e102495-e102495 (2014-07-12)
Dysfunction of Paneth and goblet cells in the intestine contributes to inflammatory bowel disease (IBD) and colitis-associated colorectal cancer (CAC). Here, we report a role for the NAD+-dependent histone deacetylase SIRT1 in the control of anti-bacterial defense. Mice with an
Joshua J Steffan et al.
The Journal of biological chemistry, 287(35), 29968-29978 (2012-07-05)
Emerging evidence suggests that the SAM pointed domain containing ETS transcription factor (SPDEF) plays a significant role in tumorigenesis in prostate, breast, colon, and ovarian cancer. However, there are no in vivo studies with respect to the role of SPDEF
Kwon-Sik Park et al.
The Journal of clinical investigation, 117(4), 978-988 (2007-03-10)
Goblet cell hyperplasia and mucous hypersecretion contribute to the pathogenesis of chronic pulmonary diseases including cystic fibrosis, asthma, and chronic obstructive pulmonary disease. In the present work, mouse SAM pointed domain-containing ETS transcription factor (SPDEF) mRNA and protein were detected
Xin-Hua Cheng et al.
PLoS genetics, 10(9), e1004656-e1004656 (2014-09-26)
SAM-pointed domain-containing ETS transcription factor (SPDEF) is expressed in normal prostate epithelium. While its expression changes during prostate carcinogenesis (PCa), the role of SPDEF in prostate cancer remains controversial due to the lack of genetic mouse models. In present study
Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..
Contacter notre Service technique