WH0008115M6

Monoclonal Anti-TCL1A antibody produced in mouse

clone 1C4, purified immunoglobulin, buffered aqueous solution

• Sinónimos: Anti-T-cell leukemia/lymphoma 1A, Anti-TCL1
• Número MDL: MFCD03456019
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: mouse
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: purified immunoglobulin
• tipo de anticuerpo: primary antibodies
• clon: 1C4, monoclonal
• formulario: buffered aqueous solution
• reactividad de especies: human
• técnicas: immunofluorescence: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotipo: IgG2bκ
• Nº de acceso GenBank: NM_021966
• Nº de acceso UniProt: P56279
• Condiciones de envío: dry ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... TCL1A(8115)

Descripción

Inmunógeno

TCL1A (NP_068801.1, 61 a.a. ~ 114 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
PMTPTQIGPSLLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDD

Forma física

Solution in phosphate buffered saline, pH 7.4

Información legal

GenBank is a registered trademark of United States Department of Health and Human Services

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable
• Equipo de protección personal: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)