SAB1404094

Monoclonal Anti-MUC5AC antibody produced in mouse

clone 2A4, purified immunoglobulin, buffered aqueous solution

• Sinónimos: MUC5
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: mouse
• conjugado: unconjugated
• forma del anticuerpo: purified immunoglobulin
• tipo de anticuerpo: primary antibodies
• clon: 2A4, monoclonal
• formulario: buffered aqueous solution
• mol peso: antigen ~37.11 kDa
• reactividad de especies: human
• técnicas: capture ELISA: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotipo: IgG2bκ
• Nº de acceso NCBI: XM_495860
• Nº de acceso UniProt: P98088
• Condiciones de envío: dry ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... MUC5AC(4586)

Descripción

Descripción general

The MUC5AC (mucin 5AC, oligomeric mucus/gel-forming) gene is mapped to human chromosome 11p15.5. Muc5ac is a gel-forming mucin of 40MDa, secreted by the goblet cells of the conjunctiva. Muc5ac is localized to the intermediate aqueous layer of tear film and predominant mucin in the respiratory tract. Muc5ac protein consists of cysteine-rich domains that flanks the central glycosylated tandem repeat domain.

Inmunógeno

MUC5AC (XP_495860, 351 a.a. ~ 450 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
NQSTCAVYHRSLIIQQQGCSSSEPVRLAYCRGNCGDSSSMYSLEGNTVEHRCQCCQELRTSLRNVTLHCTDGSSRAFSYTEVEECGCMGRRCPAPGDTQH

Aplicación

Muc5ac (mucin 5AC, oligomeric mucus/gel-forming) provides hydration and lubrication effect for epithelial cells that make up cornea and conjunctiva. Parasympathetic and sympathetic nervous system (particularly, parasympathetic neurotransmitters acetylcholine and vasoactive intestinal peptide) controls the Muc5ac secretion. A number pathogens and cytokines can also stimulate Muc5ac secretion in the airway. MUC5AC gene expression is associated with a some pathological conditions such as allergen-induced airway hyperresponsiveness,airway mucus plugging, and mucous metaplasia.

Forma física

Solution in phosphate buffered saline, pH 7.4

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable