S9697

Superoxide Dismutase bovine

recombinant, expressed in E. coli, lyophilized powder, ≥2500 units/mg protein, ≥90% (SDS-PAGE)

• Sinónimos: Superoxide Dismutase 1 bovine, cytocuprein, erythrocuprein, hemocuprein, CU/ZN-SOD, SOD, SOD1, Superoxide: superoxide oxidoreductase
• Número de CAS: 9054-89-1
• Comisión internacional de enzimas: 1.15.1.1 (BRENDA, IUBMB)
• Número CE: 232-943-0
• Número MDL: MFCD00132404
• Código UNSPSC: 12352204
• NACRES: NA.54

Propiedades

• origen biológico: bovine
• Nivel de calidad: 200
• recombinante: expressed in E. coli
• Análisis: ≥90% (SDS-PAGE)
• formulario: lyophilized powder
• actividad específica: ≥2500 units/mg protein
• condiciones de almacenamiento: (Tightly closed)
• técnicas: inhibition assay: suitable
• color: white
• pH óptimo: 7.8 (25 °C)
• intervalo de pH: 7.6-10.5
• pI: 4.95
• nota de secuencia: MATKAVCVLKGDGPVQGTIHFEAKGDTVVVTGSITGLTEGDHGFHVHQFGDNTQGCTSAGPHFNPLSKKHGGPKDEERHVGDLGNVTADKNGVAIVDIVDPLISLSGEYSIIGRTMVVHEKPDDLGRGGNEESTKTGNAGSRLACGVIGIAK
• Nº de acceso NCBI: NM_174615; NP_777040
• Nº de acceso UniProt: A4URH1
• temp. de almacenamiento: −20°C

Descripción

Descripción general

Research area: Cell Signaling

SOD from bovine erythrocytes was the first SOD to be found in mammalian tissues. There are three forms of SOD differentiated by the metal ions in the active site. These are Cu⁺²/Zn⁺², Mn⁺², and Fe⁺²SOD. In vertebrates, Cu/Zn-SOD is found in the cytoplasm, chloroplast, and may be in extracellular space, while Mn-SOD is found in the mitochondrial matrix space and peroxisome. Fe-SOD is found in the chloroplast of prokaryotes and some higher plants.

Aplicación

Superoxide Dismutase bovine has been used:

• to construct a calibration curve for the evaluation of superoxide dismutase (SOD) enzyme activities
• in a study to investigate where lipoproteins may affect the L-arginine-nitric oxide pathway
• in a study to investigate the mass spectral evidence for carbonate-anion-radical-induced posttranslational modification of tryptophan to kynurenine in human Cu, Zn superoxide dismutase

Acciones bioquímicas o fisiológicas

Superoxide dismutase (SOD) catalyzes the dismutation of superoxide radicals to hydrogen peroxide and molecular oxygen. This reaction in turn activates redox-sensitive kinases and inactivates specific phosphatases to regulate redox-sensitive signaling pathway, including hypertrophy, proliferation, and migration. SOD serves as a potent antioxidant and protects the cells against the toxic effects of oxygen radicals. SOD may also suppress apoptosis by competing with nitric oxide (NO) for superoxide anion, which reacts with NO to form peroxynitrite, an inducer of apoptosis.

Definición de unidad

One unit will inhibit reduction of cytochrome c by 50% in a coupled system with xanthine oxidase at pH 7.8 at 25°C in a 3.0 ml reaction volume. Xanthine oxidase concentration should produce an initial ΔA550 of 0.025 ± 0.005 per min.

Nota de preparación

Produced using animal component-free materials.

Reconstitución

Reconstitute in 10 mM potassium phosphate, pH 7.4.

Nota de análisis

Extinction coefficient: E^mM= 10.3 (258 nM)
SOD has no significant absorbance peak at 280 nM because of the absence of tryptophan.

Otras notas

Inhibitors: cyanide, OH^- (competitive), hydrogen peroxide

Información de seguridad

• Pictogramas: GHS08
• Palabra de señalización: Danger
• Frases de peligro: H334
• Consejos de prudencia: P261 - P284 - P501
• Clasificaciones de peligro: Resp. Sens. 1
• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable