HPA014685

Anti-MLPH antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinónimos: Anti-Exophilin-3, Anti-Melanophilin, Anti-SlaC2-a, Anti-Slp homolog lacking C2 domains a, Anti-Synaptotagmin-like protein 2a
• Código UNSPSC: 12352203
• Atlas de proteínas humanas número: HPA014685
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• Línea del producto: Prestige Antibodies^® Powered by Atlas Antibodies
• formulario: buffered aqueous glycerol solution
• reactividad de especies: human
• técnicas: immunohistochemistry: 1:20- 1:50
• secuencia del inmunógeno: ELTSNVSDQETSSEEEEAKDEKAEPNRDKSVGPLPQADPEVSDIESRIAALRAAGLTVKPSGKPRRKSNLPIFL
• Nº de acceso UniProt: Q9BV36
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... MLPH(79083)

Descripción

Descripción general

MLPH (melanophilin) belongs to the family of synaptotagmin-like proteins and is a Rab27A effector. It is a component of a tripartite complex, which also includes myosin-Va and Rab27A. Its N-terminal contains an Slp homolody domain (SHD), which interacts with GTP-bound form of Rab27A/B, and a myosin Va-binding region in its C-terminal. Also, amino acids 400-590 in the C-terminal, directly bind to actin. It contains two α-helices (SHD1 and SHD2), which are conserved in nature. These two regions are intervened by two zinc finger motifs. This gene is localized to human chromosome 2q37.3.

Inmunógeno

Melanophilin recombinant protein epitope signature tag (PrEST)

Aplicación

Anti-MLPH antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)

Acciones bioquímicas o fisiológicas

MLPH (melanophilin) acts as a receptor for myosin-Va in melanocytes. It forms part of a protein complex, which includes myosin-Va and Rab27A, and is essential for the transport of melanosome from perinuclear region to the actin-rich periphery of melanocytes. Thus, normal melanosome distribution is dependent on this protein. It acts as a linker between myosin-Va and Rab27A, and facilitates the binding of melanosomes with actin network. It might also be a key player in the instantaneous skin tanning in humans, when exposed to sun. Mutation in MLPH gene leads to mice with light coat color, called leaden mice. It is the outcome of aberrant melanosome transportation. Homozygous missense mutation occurring in the Slp homology domain of this protein is associated with Griscelli syndrome type III (GSIII). This protein is under-expressed in GSIII melanocytes, and such patients are characterized by silvery-gray hair and hypopigmentation of the skin.

Características y beneficios

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Ligadura / enlace

Corresponding Antigen APREST72718

Forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Información legal

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable