SAB1404133

Monoclonal Anti-NME2, (C-terminal) antibody produced in mouse

clone 1A9, purified immunoglobulin, buffered aqueous solution

• Synonym(s): MGC111212, NDPK-B, NDPKB, NM23-H2, NM23B, puf
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• Quality Level: 100
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 1A9, monoclonal
• form: buffered aqueous solution
• mol wt: antigen ~37.33 kDa
• species reactivity: rat, human, mouse
• technique(s): indirect ELISA: suitable; indirect immunofluorescence: suitable; western blot: 1-5 μg/mL
• isotype: IgG3κ
• NCBI accession no.: NM_002512
• UniProt accession no.: P22392
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... NME2(4831)

Description

General description

Nucleoside diphosphate kinase (NDK) exists as a hexamer composed of ′A′ (encoded by NME1) and ′B′ (encoded by this gene) isoforms. Multiple alternatively spliced transcript variants encoding the same isoform have been found for this gene. Co-transcription of this gene and the neighboring upstream gene (NME1) generates naturally-occurring transcripts (NME1-NME2) which encode a fusion protein comprised of sequence sharing identity with each individual gene product. (provided by RefSeq)

Immunogen

NME2 (NP_002503, 51 a.a. ~ 152 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
HYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE

Physical form

Solution in phosphate buffered saline, pH 7.4

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable