Skip to Content
Merck
All Photos(3)

Key Documents

AV32006

Sigma-Aldrich

Anti-SMAD5 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-SMAD family member 5

Sign Into View Organizational & Contract Pricing
All Photos(3)

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

100

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

51 kDa

species reactivity

bovine, mouse, rabbit, horse, human, rat, guinea pig, dog

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

NP_001001419

UniProt accession no.

Q99717

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... SMAD5(4090)

Looking for similar products? Visit Product Comparison Guide

General description

SMAD5 is known to mediate TGFβ signaling. Studies in mice have shown that Smad5 mutations can be linked to angiogenic defects, mesenchymal apoptosis and embryonic death.
Rabbit Anti-SMAD5 antibody recognizes bovine, chicken, human, mouse, rat, zebrafish, and canine SMAD5.

Immunogen

Synthetic peptide directed towards the middle region of human SMAD5

Application

Rabbit Anti-SMAD5 antibody can be used for western blot applications at a concentration of 1.0μg/ml.

Biochem/physiol Actions

SMAD5 undergoes copy number gain and increased expression, rather than loss of expression, and therefore does not act as a tumor-suppressor gene in hepatocellular carcinoma. Up-regulated Smad5 mediates apoptosis of gastric epithelial cells induced by Helicobacter pylori infection.

Sequence

Synthetic peptide located within the following region: YPPSPASSTYPNSPASSGPGSPFQLPADTPPPAYMPPDDQMGQDNSQPMD

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

H Chang et al.
Development (Cambridge, England), 126(8), 1631-1642 (1999-03-18)
Smad5 has been implicated as a downstream signal mediator for several bone morphogenetic proteins (BMPs). To understand the in vivo function of Smad5, we generated mice deficient in Smad5 using embryonic stem (ES) cell technology. Homozygous mutant embryos die between
X Yang et al.
Development (Cambridge, England), 126(8), 1571-1580 (1999-03-18)
The transforming growth factor-beta (TGF-beta) signals are mediated by a family of at least nine SMAD proteins, of which SMAD5 is thought to relay signals of the bone morphogenetic protein (BMP) pathway. To investigate the role of SMAD5 during vertebrate
Jonathan R Peterson et al.
Science translational medicine, 6(255), 255ra132-255ra132 (2014-09-26)
Heterotopic ossification (HO) is the pathologic development of ectopic bone in soft tissues because of a local or systemic inflammatory insult, such as burn injury or trauma. In HO, mesenchymal stem cells (MSCs) are inappropriately activated to undergo osteogenic differentiation.
Ludovic Peyre et al.
Toxicology in vitro : an international journal published in association with BIBRA, 28(8), 1507-1520 (2014-07-06)
Pesticides as well as many other environmental pollutants are considered as risk factors for the initiation and the progression of cancer. In order to evaluate the in vitro effects of chemicals present in the diet, we began by combining viability

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service