HPA035107

Anti-ARHGAP26 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonym(s): Anti-GRAF, Anti-KIAA0621, Anti-OPHN1L, Anti-OPHN1L1, Anti-Rho GTPase activating protein 26
• UNSPSC Code: 12352203
• Human Protein Atlas Number: HPA035107
• NACRES: NA.41

Properties

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• product line: Prestige Antibodies^® Powered by Atlas Antibodies
• form: buffered aqueous glycerol solution
• species reactivity: human
• enhanced validation: orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• technique(s): immunoblotting: 0.04-0.4 μg/mL; immunohistochemistry: 1:200-1:500
• immunogen sequence: HLSRKKSSDSKPPSCSERPLTLFHTVQSTEKQEQRNSIINSSLESVSSNPNSILNSSSSLQPNMNSSDPDLAVVKPTRPNSLPPNPSPTS
• UniProt accession no.: Q9UNA1
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... ARHGAP26(23092)

Description

General description

Rho GTPase activating protein 26(ARHGAP26)/GTPase Regulator Associated with Focal Adhesion Kinase (GRAF) is a multidoman membrane structuring protein involved in clathrin-independent endocytosis. GRAF interacts strongly with dynamin in the CLIC/GEEC pathway.

Specificity

Rabbit polyclonal anti-ARHGAP26 antibody reacts with human Rho GTPase activating protein 26/ GTPase Regulator Associated with Focal Adhesion Kinase (GRAF).

Immunogen

Rho GTPase activating protein 26 recombinant protein epitope signature tag (PrEST)

Application

Rabbit polyclonal anti-ARHGAP26 antibody is used to tag Rho GTPase activating protein 26/ GTPase Regulator Associated with Focal Adhesion Kinase (GRAF) for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of Rho GTPase activating protein 26/ GTPase Regulator Associated with Focal Adhesion Kinase (GRAF) in clathrin-independent endocytosis involving the CLIC/GEEC pathway.

Features and Benefits

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST78333

Physical form

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable