SAB1404114

Monoclonal Anti-NDUFS4, (C-terminal) antibody produced in mouse

clone 1A1, ascites fluid

• Synonym(e): AQDQ
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: mouse
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: ascites fluid
• Antikörper-Produkttyp: primary antibodies
• Klon: 1A1, monoclonal
• Mol-Gew.: antigen ~38.21 kDa
• Speziesreaktivität: human
• Methode(n): indirect ELISA: suitable; western blot: 1:500-1:1000
• Isotyp: IgG2aκ
• NCBI-Hinterlegungsnummer: NM_002495
• UniProt-Hinterlegungsnummer: O43181
• Versandbedingung: dry ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... NDUFS4(4724)

Beschreibung

Allgemeine Beschreibung

This gene encodes an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), or NADH:ubiquinone oxidoreductase, the first multi-subunit enzyme complex of the mitochondrial respiratory chain. Complex I plays a vital role in cellular ATP production, the primary source of energy for many crucial processes in living cells. It removes electrons from NADH and passes them by a series of different protein-coupled redox centers to the electron acceptor ubiquinone. In well-coupled mitochondria, the electron flux leads to ATP generation via the building of a proton gradient across the inner membrane. Complex I is composed of at least 41 subunits, of which 7 are encoded by the mitochondrial genome and the remainder by nuclear genes. (provided by RefSeq)

Immunogen

NDUFS4 (NP_002486, 66 a.a. ~ 175 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
GVPEEHIKTRKVRIFVPARNNMQSGVNNTKKWKMEFDTRERWENPLMGWASTADPLSNMVLTFSTKEDAVSFAEKNGWSYDIEERKVPKPKSKSYGANFSWNKRTRVSTK

Physikalische Form

Clear solution

Sicherheitshinweise

• Lagerklassenschlüssel: 11 - Combustible Solids
• WGK: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable