Direkt zum Inhalt
Merck

HPA051516

Sigma-Aldrich

Anti-MAN1B1 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(e):

Anti-MANA-ER, Anti-MRT15

Anmeldenzur Ansicht organisationsspezifischer und vertraglich vereinbarter Preise


About This Item

UNSPSC-Code:
12352203
Human Protein Atlas-Nummer:
NACRES:
NA.41

Biologische Quelle

rabbit

Qualitätsniveau

Konjugat

unconjugated

Antikörperform

affinity isolated antibody

Antikörper-Produkttyp

primary antibodies

Klon

polyclonal

Produktlinie

Prestige Antibodies® Powered by Atlas Antibodies

Form

buffered aqueous glycerol solution

Speziesreaktivität

human

Methode(n)

immunohistochemistry: 1:50- 1:200

Immunogene Sequenz

METGLSPEIVHFNLYPQPGRRDVEVKPADRHNLLRPETVESLFYLYRVTGDRKYQDWGWEILQSFSRFTRVPSGGYSSINNVQDPQKP

UniProt-Hinterlegungsnummer

Versandbedingung

wet ice

Lagertemp.

−20°C

Posttranslationale Modifikation Target

unmodified

Angaben zum Gen

human ... MAN1B1(11253)

Allgemeine Beschreibung

Mannosidase alpha class 1B member 1 (MAN1B1), also called endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase, is a 79.5 kDa type II membrane protein. It has a cytoplasmic tail, transmembrane domain, middle stem region and a large catalytic domain at the C-terminus.(1) MAN1B1 gene has 13 exons and is mapped to human chromosome 9q34.3.

Immunogen

mannosidase, alpha, class 1B, member 1 recombinant protein epitope signature tag (PrEST)

Anwendung

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem./physiol. Wirkung

Mannosidase alpha class 1B member 1 (MAN1B1) catalyses the removal of mannose residues during N-glycan biosynthesis. It is part of endoplasmic reticulum associated degradation (ERAD) of glycoproteins. It is also part of the endoplasmic reticulum (ER) quality control machinery. Mutation in MAN1B1 is implicated in nonsyndromic autosomal-recessive intellectual disability disorder. Deficiency of MAN1B1 impacts N-glycosylation and is associated with congenital disorders of glycosylation (CDG). MAN1B1 is highly expressed in bladder cancer and silencing of its expression impacts the cancer progression, making MAN1B1 a potential drug target.

Leistungsmerkmale und Vorteile

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST85733

Physikalische Form

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Sie haben nicht das passende Produkt gefunden?  

Probieren Sie unser Produkt-Auswahlhilfe. aus.

Lagerklassenschlüssel

10 - Combustible liquids

WGK

WGK 1

Flammpunkt (°F)

Not applicable

Flammpunkt (°C)

Not applicable


Analysenzertifikate (COA)

Suchen Sie nach Analysenzertifikate (COA), indem Sie die Lot-/Chargennummer des Produkts eingeben. Lot- und Chargennummern sind auf dem Produktetikett hinter den Wörtern ‘Lot’ oder ‘Batch’ (Lot oder Charge) zu finden.

Besitzen Sie dieses Produkt bereits?

In der Dokumentenbibliothek finden Sie die Dokumentation zu den Produkten, die Sie kürzlich erworben haben.

Die Dokumentenbibliothek aufrufen

MAN1B1 is associated with poor prognosis and modulates proliferation and apoptosis in bladder cancer
Wang HF, et al.
Gene, 679(12), 314-319 (2018)
Mammalian ER mannosidase I resides in quality control vesicles, where it encounters its glycoprotein substrates
Benyair R, et al.
Molecular Biology of the Cell, 26(2), 172-184 (2015)
MAN1B1 deficiency: an unexpected CDG-II
Rymen D, et al.
PLoS Genetics, 9(12), e1003989-e1003989 (2013)
MAN1B1 mutation leads to a recognizable phenotype: a case report and future prospects
Hoffjan S, et al.
Molecular Syndromology, 6(2), 58-62 (2015)
Mutations in the alpha 1, 2-mannosidase gene, MAN1B1, cause autosomal-recessive intellectual disability
Rafiq MA, et al.
American Journal of Human Genetics, 89(1), 176-182 (2011)

Unser Team von Wissenschaftlern verfügt über Erfahrung in allen Forschungsbereichen einschließlich Life Science, Materialwissenschaften, chemischer Synthese, Chromatographie, Analytik und vielen mehr..

Setzen Sie sich mit dem technischen Dienst in Verbindung.