SAB1407998

Anti-PHF17 antibody produced in mouse

purified immunoglobulin, buffered aqueous solution

• Synonym(s): FLJ22479, JADE1, KIAA1807
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• Quality Level: 100
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: antigen ~58.4 kDa
• species reactivity: human
• technique(s): indirect immunofluorescence: suitable; western blot: 1 μg/mL
• NCBI accession no.: NM_024900
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... PHF17(79960)

Description

General description

Mouse polyclonal antibody raised against a full-length human PHF17 protein.

PHF17 (PHD finger protein 17) is a short-lived, kidney-enriched Jade protein consisting of canonical plant homeodomain (PHD) finger protein and a non-canonical extended PHD with zinc-binding ability. It is localized in the nucleus and is highly expressed in the kidney and renal proximal tubule cells.

Immunogen

PHF17 (NP_079176.2, 1 a.a. ~ 509 a.a) full-length human protein.

Sequence
MKRGRLPSSSEDSDDNGSLSTTWSQNSRSQHRRSSCSRHEDRKPSEVFRTDLITAMKLHDSYQLNPDEYYVLADPWRQEWEKGVQVPVSPGTIPQPVARVVSEEKSLMFIRPKKYIVSSGSEPPELGYVDIRTLADSVCRYDLNDMDAAWLELTNEEFKEMGMPELDEYTMERVLEEFEQRCYDNMNHAIETEEGLGIEYDEDVVCDVCQSPDGEDGNEMVFCDKCNICVHQACYGILKVPEGSWLCRTCALGVQPKCLLCPKKGGAMKPTRSGTKWVHVSCALWIPEVSIGSPEKMEPITKVSHIPSSRWALVCSLCNEKFGASIQCSVKNCRTAFHVTCAFDRGLEMKTILAENDEVKFKSYCPKHSSHRKPEESLGKGAAQENGAPECSPRNPLEPFASLEQNREEAHRVSVRKQKLQQLEDEFYTFVNLLDVARALRLPEEVVDFLYQYWKLKRKVNFNKPLITPKKDEEDNLAKREQDVLFRRLQLFTHLRQDLERVMIDTDTL

Application

Anti-PHF17 antibody produced in mouse is suitable for indirect immunofluorescence and western blot analysis.

Biochem/physiol Actions

PHF17 (PHD finger protein 17) is associated with several cellular activities such as chromatin remodeling, renal tubular epithelial cell differentiation, growth suppression, apoptosis and protein-protein interactions. It possesses transcriptional and endogenous histone acetyltransferase (HAT) activity. It acts as a transcriptional co-activator in the TIP60 mediated histone H4/H2A specific HAT activity. It has been reported that PHF17 may play a role in the renal cancer and von Hippel-Lindau disease. PHF17 also possesses tumour suppressor property. In the renal tumorigenesis, it controls canonical Wnt signaling pathway by ubiquitylating oncoprotein β-catenin in Wnt-responsive manner.

Physical form

Solution in phosphate buffered saline, pH 7.4

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable