Passa al contenuto
Merck
Tutte le immagini(5)

Key Documents

WH0005081M3

Sigma-Aldrich

Monoclonal Anti-PAX7 antibody produced in mouse

clone 3C9, purified immunoglobulin, buffered aqueous solution

Sinonimo/i:

Anti-HUP1, Anti-paired box gene 7

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
Tutte le immagini(5)

About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

mouse

Livello qualitativo

100

Coniugato

unconjugated

Forma dell’anticorpo

purified immunoglobulin

Tipo di anticorpo

primary antibodies

Clone

3C9, monoclonal

Forma fisica

buffered aqueous solution

Reattività contro le specie

mouse

tecniche

indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotipo

IgG2aκ

N° accesso Genebanck

NM_002584

N° accesso UniProt

P47239

Condizioni di spedizione

dry ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... PAX7(5081)

Descrizione generale

Paired box 7 (PAX7) gene is located on human chromosome 1p36.13.

Immunogeno

PAX7 (NP_002575.1, 411 a.a. ~ 520 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
GGLDSATSISASCSQRADSIKPGDSLPTSQAYCPPTYSTTGYSVDPVAGYQYGQYGQSECLVPWASPVPIPSPTPRASCLFMESYKVVSGWGMSISQMEKLKSSQMEQFT

Azioni biochim/fisiol

Paired box 7 (PAX7) plays a key role in myogenic satellite cell specification, by blocking alternate developmental programs. Aberration in the gene expression is associated with melanoma, neuroblastoma and rhabdomyosarcoma. PAX7 participates in the formation of skeletal muscle and regeneration.

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Note legali

GenBank is a registered trademark of United States Department of Health and Human Services

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Dispositivi di protezione individuale

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Certificati d'analisi (COA)

Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

The role of Pax genes in the development of tissues and organs: Pax3 and Pax7 regulate muscle progenitor cell functions
Buckingham, et al.
Annual Review of Cell and Developmental Biology, 23(6), 645-673 (2007)
P Seale et al.
Cell, 102(6), 777-786 (2000-10-13)
The paired box transcription factor Pax7 was isolated by representational difference analysis as a gene specifically expressed in cultured satellite cell-derived myoblasts. In situ hybridization revealed that Pax7 was also expressed in satellite cells residing in adult muscle. Cell culture
T H Beaty et al.
Human genetics, 132(7), 771-781 (2013-03-21)
A collection of 1,108 case-parent trios ascertained through an isolated, nonsyndromic cleft lip with or without cleft palate (CL/P) was used to replicate the findings from a genome-wide association study (GWAS) conducted by Beaty et al. (Nat Genet 42:525-529, 2010)
Lerrie Ann Ipulan et al.
Endocrinology, 155(7), 2467-2479 (2014-04-20)
The bulbocavernosus (BC) is a sexually dimorphic muscle observed only in males. Androgen receptor knockout mouse studies show the loss of BC formation. This suggests that androgen signaling plays a vital role in its development. Androgen has been known to
Takahiko Sato et al.
Nature communications, 5, 4597-4597 (2014-08-15)
Skeletal muscle stem cells (MuSCs), the major source for skeletal muscle regeneration in vertebrates, are in a state of cell cycle arrest in adult skeletal muscles. Prior evidence suggests that embryonic muscle progenitors proliferate and differentiate to form myofibres and
Visualizza tutti i documenti correlati

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.