SAB5702263

Anti-CPT1A Antibody, clone 3M6E9, Rabbit Monoclonal

• Sinonimo/i: CPT1A,CPT1,CPT1-L,L-CPT1
• Codice UNSPSC: 12352203
• NACRES: NA.46

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Materiali: colorless
• Clone: 3M6E9, monoclonal
• Forma fisica: liquid
• PM: 88 kDa
• Reattività contro le specie: rat, rat, human
• Concentrazione: 1 mg/mL
• tecniche: western blot: 1:500 - 1:1000
• Colore: colorless
• Isotipo: IgG
• Sequenza immunogenica: WDIPGECQEVIETSLNTANLLANDVDFHSFPFVAFGKGIIKKCRTSPDAFVQLALQLAHYKDMGKFCLTYEASMTRLFREGRTETVRSCTTESCDFVRAMVDPAQTVEQRLKLFKLASEKHQHMYRLAMTGSGIDRHLFCLYVVSKYLAVESPFLKEVLSEPWRLSTSQTPQQQVELFDLENNPEYVSSGGGFGPVADDGY
• N° accesso UniProt: P50416
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... CPT1A(1374)

Descrizione

Descrizione generale

The mitochondrial oxidation of long-chain fatty acids is initiated by the sequential action of carnitine palmitoyltransferase I (which is located in the outer membrane and is detergent-labile) and carnitine palmitoyltransferase II (which is located in the inner membrane and is detergent-stable), together with a carnitine-acylcarnitine translocase. CPT I is the key enzyme in the carnitine-dependent transport across the mitochondrial inner membrane and its deficiency results in a decreased rate of fatty acid beta-oxidation. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Immunogeno

PBS with 0.05% proclin300,0.05% BSA,50% glycerol,pH7.3.

Recombinant fusion protein containing a sequence corresponding to amino acids 520-720 of human CPT1A (NP_001867.2).

Applicazioni

WB

Informazioni sulla sicurezza

• Pittogrammi: GHS07,GHS09
• Avvertenze: Warning
• Indicazioni di pericolo: H317,H411
• Consigli di prudenza: P261 - P272 - P273 - P280 - P302 + P352 - P333 + P313
• Classi di pericolo: Aquatic Chronic 2 - Skin Sens. 1
• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3