SAB2108792

Anti-BLOC1S1 (N-terminal) antibody produced in rabbit FITC conjugated

affinity isolated antibody

• Sinonimo/i: GCAP-I, GUANYLIN, GUCA2, STARA
• Codice UNSPSC: 12352203
• NACRES: NA.45

Proprietà

• Origine biologica: rabbit
• Coniugato: FITC conjugate
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Forma fisica: buffered aqueous solution
• PM: 16 kDa
• Reattività contro le specie (prevista in base all’omologia): guinea pig, mouse, canine, horse, human, rabbit, bovine, rat
• Concentrazione: 0.5 mg/mL
• N° accesso NCBI: NM_001487
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... BLOC1S1(2647)

Descrizione

Descrizione generale

BLOC1S1 is a component of the ubiquitously expressed BLOC1 multisubunit protein complex. BLOC1 is required for normal biogenesis of specialized organelles of the endosomal-lysosomal system, such as melanosomes and platelet dense granules.

Immunogeno

Synthetic peptide directed towards the N-terminal region of Human BLOC1S1

Sequenza

Synthetic peptide located within the following region: SPQPDVTMLSRLLKEHQAKQNERKELQEKRRREAITAATCLTEALVDHLN

Stato fisico

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 12 - Non Combustible Liquids
• Classe di pericolosità dell'acqua (WGK): WGK 1
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable