AV50600

Anti-SENP6 antibody produced in rabbit

affinity isolated antibody

• Sinonimo/i: Anti-FLJ11355, Anti-FLJ11887, Anti-KIAA0389, Anti-KIAA0797, Anti-SSP1, Anti-SUMO1/Sentrin specific peptidaSe 6, Anti-SUSP1
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Forma fisica: buffered aqueous solution
• PM: 125 kDa
• Reattività contro le specie: human
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: western blot: suitable
• N° accesso NCBI: NP_056386
• N° accesso UniProt: Q9GZR1
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... SENP6(26054)

Descrizione

Descrizione generale

SENP6 is a SUMO-deconjugating enzyme that negatively modulates TLR-mediated inflammatory signaling. Studies have reported that SENP6 also regulates PML nuclear bodies and is required for inner kinetochore assembly.
Rabbit Anti-SENP6 antibody recognizes human SENP6.

Immunogeno

Synthetic peptide directed towards the C terminal region of human SENP6

Applicazioni

Rabbit Anti-SENP6 antibody is suitable for western blot applications at a concentration of 1μg/ml.

Azioni biochim/fisiol

SENP6 is a UBL-specific protease that deconjugates SUMO1, SUMO2 and SUMO3 from targeted proteins. It does not seem to be involved in the processing of full-length SUMO proteins to their mature forms. SENP6 deconjugates SUMO1 from RXRA, leading to transcriptional activation. It may act preferentially on substrates containing 3 or more SUMO2 or SUMO3 moieties.Ubiquitin-like molecules (UBLs), such as SUMO1 (UBL1; MIM 601912), are structurally related to ubiquitin (MIM 191339) and can be ligated to target proteins in a similar manner as ubiquitin. However, covalent attachment of UBLs does not result in degradation of the modified proteins. SUMO1 modification is implicated in the targeting of RANGAP1 (MIM 602362) to the nuclear pore complex, as well as in stabilization of I-kappa-B-alpha (NFKBIA; MIM 164008) from degradation by the 26S proteasome. Like ubiquitin, UBLs are synthesized as precursor proteins, with 1 or more amino acids following the C-terminal glycine-glycine residues of the mature UBL protein. Thus, the tail sequences of the UBL precursors need to be removed by UBL-specific proteases, such as SENP6, prior to their conjugation to target proteins (Kim et al., 2000 [PubMed 10799485]).[supplied by OMIM].

Sequenza

Synthetic peptide located within the following region: MNLANWFPPPRMRTKREEIRNIILKLQEDQSKEKRKHKDTYSTEAPLGEG

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable