Accéder au contenu
Merck
Toutes les photos(2)

Documents

WH0003559M4

Sigma-Aldrich

Monoclonal Anti-IL2RA antibody produced in mouse

clone 1D6, purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

Anti-CD25, Anti-IL2R, Anti-TCGFR, Anti-interleukin 2 receptor, alpha

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(2)

About This Item

Numéro MDL:
MFCD00164687
Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

mouse

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

1D6, monoclonal

Forme

buffered aqueous solution

Espèces réactives

human

Technique(s)

indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotype

IgG2aκ

Numéro d'accès GenBank

NM_000417

Numéro d'accès UniProt

P01589

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... IL2RA(3559)

Description générale

Interleukin 2 receptor alpha (IL2RA) is a part of the IL-2 receptor. It is expressed on regulatory T cells. IL2RA gene is mapped to human chromosome 10p15.1.

Immunogène

IL2RA (NP_000408, 22 a.a. ~ 122 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
ELCDDDPPEIPHATFKAMAYKEGTMLNCECKRGFRRIKSGSLYMLCTGNSSHSSWDNQCQCTSSATRNTTKQVTPQPEEQKERKTTEMQSPMQPVDQASL*

Actions biochimiques/physiologiques

Interleukin 2 receptor alpha (IL2RA) combines with a tri-molecular complex to exhibit a high-affinity receptor for IL-2. Activated immune cells release IL2RA and produce soluble (sIL2RA). Higher circulating levels of sIL2RA leads to multiple sclerosis (MS) disease activities. IL2RA initiates T cell proliferation in an autocrine and paracrine manner. Elevated levels of IL-2R is detected in coronavirus disease 2019 (COVID-19)infected patients.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations légales

GenBank is a registered trademark of United States Department of Health and Human Services

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Outil de sélection de produits.

En option

Réf. du produit
Description
Tarif

Code de la classe de stockage

10 - Combustible liquids

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Équipement de protection individuelle

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Max Mimpen et al.
Journal of neuroimmunology, 353, 577499-577499 (2021-02-03)
NK/T-cell ratios predict disease activity in relapsing remitting multiple sclerosis (RRMS). We investigated in 50 RRMS patients whether interleukin-2 receptor alpha-chain (IL-2Rα) expression and shedding associates with NK/T-cell balance, as suggested by daclizumab-trials in RRMS. A subsample (N = 31) was genotyped
Víctor J Costela-Ruiz et al.
Cytokine & growth factor reviews, 54, 62-75 (2020-06-10)
COVID-19 disease, caused by infection with SARS-CoV-2, is related to a series of physiopathological mechanisms that mobilize a wide variety of biomolecules, mainly immunological in nature. In the most severe cases, the prognosis can be markedly worsened by the hyperproduction
Daniela B Engler et al.
Proceedings of the National Academy of Sciences of the United States of America, 111(32), 11810-11815 (2014-07-31)
The prevalence of allergic asthma and other atopic diseases has reached epidemic proportions in large parts of the developed world. The gradual loss of the human indigenous microbiota has been held responsible for this trend. The bacterial pathogen Helicobacter pylori
Hong Guo et al.
Journal of leukocyte biology, 96(3), 419-426 (2014-05-29)
C/EBPα is expressed preferentially in myeloid compared with lymphoid or erythroid cells and directs myeloid lineage specification. C/EBPα is also expressed at lower levels in HSCs and in several nonhematopoietic tissues. The Cebpa gene has a conserved, 450-bp segment at
Fanhang Meng et al.
Inflammation, 37(5), 1799-1805 (2014-05-03)
Myeloid-derived suppressor cells (MDSCs) are negative regulators of the immune response and are in part responsible for the inhibition of the T cell-mediated immune response. A recent paper indicated that MDSCs were involved in prolonged allograft survival in animal models
Afficher tous les articles scientifiques apparentés

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique