WH0001827M1

Monoclonal Anti-DSCR1 antibody produced in mouse

clone 1G7, ascites fluid

• Synonyme(s) : Anti-ADAPT78, Anti-CSP1, Anti-DSC1, Anti-Down syndrome critical region gene 1, Anti-MCIP1, Anti-RCN1
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: mouse
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: ascites fluid
• Type de produit anticorps: primary antibodies
• Clone: 1G7, monoclonal
• Espèces réactives: human
• Technique(s): indirect ELISA: suitable; western blot: 1:500-1:1000
• Isotype: IgG1κ
• Numéro d'accès GenBank: BC002864
• Numéro d'accès UniProt: P53805
• Conditions d'expédition: dry ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... RCAN1(1827)

Description

Description générale

The protein encoded by this gene interacts with calcineurin A and inhibits calcineurin-dependent signaling pathways, possibly affecting central nervous system development. This gene is located in the minimal candidate region for the Down syndrome phenotype, and is overexpressed in the brain of Down syndrome fetuses. Chronic overexpression of this gene may lead to neurofibrillary tangles such as those associated with Alzheimer disease. Three transcript variants encoding three different isoforms have been found for this gene. (provided by RefSeq)

Immunogène

DSCR1 (AAH02864, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MEEVDLQDLPSATIACHLDPRVFVDGLCRAKFESLFRTYDKDITFQYFKSFKRVRINFSNPFSAADARLQLHKTEFLGKEMKLYFAQTLHIGSSHLAPPN

Forme physique

Solution

Informations légales

GenBank is a registered trademark of United States Department of Health and Human Services

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable
• Équipement de protection individuelle: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)