SAB5702193

Anti-PGC1α/β Antibody, clone 5K0F4, Rabbit Monoclonal

• Synonyme(s) : LEM6,PGC-1(alpha),PGC-1alpha,PGC-1v,PGC1,PGC1A,PPARGC1,ERRL1,PERC,PGC-1(beta),PGC1B
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.46

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Matériaux: colorless
• Clone: 5K0F4, monoclonal
• Forme: liquid
• Poids mol.: 113 kDa
• Espèces réactives: rat, mouse
• Concentration: 2 mg/mL
• Technique(s): western blot: 1:500 - 1:2000
• Couleur: colorless
• Isotype: IgG
• Séquence immunogène: VFGEIEECTVNLRDDGDSYGFITYRYTCDAFAALENGYTLRRSNETDFELYFCGRKQFFKSNYADLDSNSDDFDPASTKSKYDSLDFDSLLKEAQRSLRR
• Numéro d'accès UniProt: Q86YN6; Q9UBK2
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... PGC1α(10891)

Description

Description générale

The protein encoded by this gene is a transcriptional coactivator that regulates the genes involved in energy metabolism. This protein interacts with PPARgamma, which permits the interaction of this protein with multiple transcription factors. This protein can interact with, and regulate the activities of, cAMP response element binding protein (CREB) and nuclear respiratory factors (NRFs). It provides a direct link between external physiological stimuli and the regulation of mitochondrial biogenesis, and is a major factor that regulates muscle fiber type determination. This protein may be also involved in controlling blood pressure, regulating cellular cholesterol homoeostasis, and the development of obesity.

Immunogène

A synthetic peptide corresponding to a sequence within amino acids 699-798 of human PGC1α/β (Q9UBK2).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Application

WB

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1