Accéder au contenu
Merck
Toutes les photos(3)

Key Documents

SAB2108447

Sigma-Aldrich

Anti-BAX

IgG fraction of antiserum

Synonyme(s) :

Anti-CLECSF10

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(3)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Conjugué

unconjugated

Forme d'anticorps

IgG fraction of antiserum

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

21 kDa

Espèces réactives

bovine, human, dog, pig

Concentration

0.5-1 mg/mL

Technique(s)

immunoblotting: suitable
immunohistochemistry: suitable

Numéro d'accès

NM_138761

Numéro d'accès UniProt

Q07812

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... BAX(581)

Description générale

B-cell lymphoma 2 associated X (BAX), also known as CLECSF10 (C-type lectin superfamily member 10), is located on human chromosome 19q13. BAX is a proapoptotic protein and is a member of Bcl-2 protein family.

Immunogène

Synthetic peptide directed towards the N terminal region of human BAX

Application

Anti-BAX has been used in Western blotting.

Actions biochimiques/physiologiques

B-cell lymphoma 2 associated X (BAX) promotes cell death and plays a vital role in regulation of apoptosis. BAX gene may act as a negative regulator of autophagy in CRC (colorectal cancer) development.

Séquence

Synthetic peptide located within the following region: MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPV

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

12 - Non Combustible Liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Enhanced radiation effect on SMCC7721 cells through endoplasmic reticulum stress induced by C225-GNPs in vitro and in vivo
Zhu C, et al.
Oncology Letters, 15, 4221-4228 (2018)
Cytoprotective Peptide Humanin Binds and Inhibits Proapoptotic Bcl-2/Bax Family Protein BimEL
Luciano F, et al.
The Journal of Biological Chemistry, 280, 15825-15835 (2005)
Immediate early up-regulation of bax expression by p53 but not TGF beta 1: a paradigm for distinct apoptotic pathways.
Selvakumaran M, et al.
Oncogene, 9, 1791-1798 (1994)
The BAX gene as a candidate for negative autophagy-related genes regulator on mRNA levels in colorectal cancer
Gil J, et al.
Medical Oncology (Northwood, London, England), 34 (2017)
The substitution of Proline 168 favors Bax oligomerization and stimulates its interaction with LUVs and mitochondria.
Simonyan L, et al.
Biochimica et Biophysica Acta, 1859, 1144-1155 (2017)
Afficher tous les articles scientifiques apparentés

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique