SAB2102648

Anti-UHRF2 antibody produced in rabbit

affinity isolated antibody

• Synonyme(s) : Anti-DKFZp434B0920, Anti-DKFZp686G0837, Anti-MGC33463, Anti-NIRF, Anti-Ubiquitin-like, containing PHD and RING finger domains, 2
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Forme: buffered aqueous solution
• Poids mol.: 90 kDa
• Espèces réactives: guinea pig, horse, rabbit, human, mouse, dog, bovine, rat
• Concentration: 0.5 mg - 1 mg/mL
• Technique(s): western blot: suitable
• Numéro d'accès UniProt: Q96PU4
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... UHRF2(115426)

Description

Description générale

Ubiquitin like with PHD and ring finger domains 2 (UHRF2) belongs to the ubiquitin plant homeodomain RING finger (UHRF) family. The gene is located on human chromosome 9p24.1. The protein consists of ubiquitin-like (UBL) domain, tandem tudor domain (TTD), plant homeodomain (PHD) finger domain, SET and RING associated (SRA) domain and RING finger domain.

Immunogène

Synthetic peptide directed towards the middle region of human UHRF2

Actions biochimiques/physiologiques

Ubiquitin like with PHD and ring finger domains 2 (UHRF2) encodes a nuclear protein which is involved in cell-cycle regulation. The encoded protein is a ubiquitin-ligase capable of ubiquinating PCNP (PEST-containing nuclear protein), and together they may play a role in tumorigenesis.
UHRF2 is overexpressed in colorectal cancer cells and functions as an oncogene in breast cancer cells. UHRF2 domains are required for the regulation of cell cycle network, epigenetic system and UPS (ubiquitin proteasome system). The protein plays an important role in the nuclear degradation of polyglutamine aggregates. UHRF2 is involved in the DNA damage repair of aortic vascular smooth muscle cells.

Séquence

Synthetic peptide located within the following region: NCDAPLDDKIGAESRNWRAGKPVRVIRSFKGRKISKYAPEEGNRYDGIYK

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 3
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable